Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G03480 64 / 5e-13 CHAT acetyl CoA:(Z)-3-hexen-1-ol acetyltransferase (.1) AT5G17540 56 / 3e-10 HXXXD-type acyl-transferase family protein (.1) AT5G41040 45 / 9e-07 HXXXD-type acyl-transferase family protein (.1.2) AT2G25150 41 / 3e-05 HXXXD-type acyl-transferase family protein (.1) AT1G03390 41 / 4e-05 HXXXD-type acyl-transferase family protein (.1) AT2G23510 41 / 5e-05 SDT spermidine disinapoyl acyltransferase (.1) AT5G63560 37 / 0.0007 HXXXD-type acyl-transferase family protein (.1) AT5G23970 37 / 0.0009 HXXXD-type acyl-transferase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005659 [exp] 197 / 8e-63 AT5G17540 406 / 6e-139 HXXXD-type acyl-transferase family protein (.1) Lus10005662 [exp] 99 / 3e-28 AT5G17540 92 / 4e-23 HXXXD-type acyl-transferase family protein (.1) Lus10020331 [exp] 101 / 2e-26 AT5G17540 504 / 4e-177 HXXXD-type acyl-transferase family protein (.1) Lus10005661 [exp] 92 / 3e-23 AT5G17540 412 / 7e-142 HXXXD-type acyl-transferase family protein (.1) Lus10005660 [exp] 91 / 1e-22 AT5G17540 461 / 4e-160 HXXXD-type acyl-transferase family protein (.1) Lus10020332 [exp] 91 / 2e-22 AT5G17540 464 / 3e-161 HXXXD-type acyl-transferase family protein (.1) Lus10020330 [exp] 77 / 1e-17 AT5G17540 436 / 2e-150 HXXXD-type acyl-transferase family protein (.1) Lus10026871 [exp] 73 / 3e-16 AT3G09720 673 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10001027 [exp] 67 / 2e-14 AT5G17540 210 / 1e-64 HXXXD-type acyl-transferase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G074500 [exp] 86 / 5e-21 AT5G17540 547 / 0.0 HXXXD-type acyl-transferase family protein (.1) Potri.013G074400 [exp] 85 / 2e-20 AT5G17540 518 / 0.0 HXXXD-type acyl-transferase family protein (.1) Potri.019G003000 [exp] 84 / 3e-20 AT5G17540 480 / 9e-168 HXXXD-type acyl-transferase family protein (.1) Potri.013G112100 [exp] 82 / 1e-19 AT5G17540 378 / 7e-128 HXXXD-type acyl-transferase family protein (.1) Potri.019G043600 [exp] 82 / 2e-19 AT5G17540 545 / 0.0 HXXXD-type acyl-transferase family protein (.1) Potri.019G002900 [exp] 80 / 8e-19 AT5G17540 481 / 5e-168 HXXXD-type acyl-transferase family protein (.1) Potri.013G074300 [exp] 79 / 1e-18 AT5G17540 497 / 7e-175 HXXXD-type acyl-transferase family protein (.1) Potri.003G019900 [exp] 76 / 2e-17 AT5G17540 410 / 3e-140 HXXXD-type acyl-transferase family protein (.1) Potri.001G448000 [exp] 71 / 1e-15 AT5G17540 400 / 4e-136 HXXXD-type acyl-transferase family protein (.1) Potri.001G127600 [exp] 71 / 2e-15 AT5G17540 406 / 1e-138 HXXXD-type acyl-transferase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0149 [flax] [poplar] CoA-acyltrans PF02458 [flax] [poplar] Transferase Transferase family
Representative CDS sequence Show only first row Show all	>Lus10020334 pacid=23144048 polypeptide=Lus10020334 locus=Lus10020334.g ID=Lus10020334.BGIv1.0 annot-version=v1.0 ATGGCATTGTTCTCAATGACCAAGTGGACGTTCCTAGTATCGGATGTGACTCGGGCTGGGTTTGGTTCCGTGGATTTCGGTTGGGGCGAGGCCATCTACG CCGGTCCAGCGGAGACGAATGTCGGGCCAATTGAAGGAGTGACGAATATTTTTGTGCCGGGGAAGAATAAGGAAGGGGAGGATGGGATTATTGTAGCAAT CAGTTTGCCGGCGGAGGCCATGGGACGGTTTGAACAAGAGTTGGAGAGCTTGTTTAAAGGAGCTCGCTCCAGCGCCGGAGACAATATGGACTACATTAGA TCGGCTTTATAA
AA sequence Show only first row Show all	>Lus10020334 pacid=23144048 polypeptide=Lus10020334 locus=Lus10020334.g ID=Lus10020334.BGIv1.0 annot-version=v1.0 MALFSMTKWTFLVSDVTRAGFGSVDFGWGEAIYAGPAETNVGPIEGVTNIFVPGKNKEGEDGIIVAISLPAEAMGRFEQELESLFKGARSSAGDNMDYIR SAL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G03480		CHAT	acetyl CoA:(Z)-3-hexen-1-ol ac...		Lus10020334 [exp]	0	1
AT5G20810			SAUR-like auxin-responsive pro...		Lus10034888 [exp]	4.0	0.7463
AT1G26730			EXS (ERD1/XPR1/SYG1) family pr...		Lus10004284 [exp]	4.7	0.7503
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10013920 [exp]	8.3	0.7396
AT5G45670			GDSL-like Lipase/Acylhydrolase...		Lus10015241 [exp]	9.6	0.7396
AT2G27520			F-box and associated interacti...		Lus10004586 [exp]	9.8	0.6905
AT2G16730		BGAL13	beta-galactosidase 13, glycosy...		Lus10014126 [exp]	10.7	0.7396
AT5G20260			Exostosin family protein (.1)		Lus10039980 [exp]	11.7	0.7396
AT5G33340		CDR1	CONSTITUTIVE DISEASE RESISTANC...		Lus10002612 [exp]	11.8	0.7310
AT3G14250			RING/U-box superfamily protein...		Lus10022064 [exp]	14.5	0.7154
AT1G22380		ATUGT85A3	UDP-glucosyl transferase 85A3 ...		Lus10013919 [exp]	14.7	0.7282

Compare expression of checked genes

Lus10020334 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.