Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G43570 51 / 2e-08 CHI "chitinase, putative", chitinase, putative (.1) AT2G43620 50 / 6e-08 Chitinase family protein (.1) AT2G43580 49 / 8e-08 Chitinase family protein (.1) AT2G43590 48 / 2e-07 Chitinase family protein (.1) AT3G54420 48 / 2e-07 ATCHITIV, CHIV, ATEP3 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1) AT2G43610 48 / 3e-07 Chitinase family protein (.1) AT2G43600 42 / 4e-05 Chitinase family protein (.1) AT3G12500 39 / 0.0005 PR-3, PR3, CHI-B, B-CHI, ATHCHIB PATHOGENESIS-RELATED 3, basic chitinase (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001773 [exp] 66 / 4e-14 AT2G43570 51 / 6e-08 "chitinase, putative", chitinase, putative (.1) Lus10020253 [exp] 62 / 5e-13 AT2G43610 54 / 4e-09 Chitinase family protein (.1) Lus10028377 [exp] 49 / 2e-07 AT3G12500 393 / 1e-137 PATHOGENESIS-RELATED 3, basic chitinase (.1) Lus10025948 [exp] 48 / 2e-07 AT2G43610 50 / 3e-07 Chitinase family protein (.1) Lus10000453 [exp] 48 / 4e-07 AT3G54420 382 / 3e-135 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1) Lus10041830 [exp] 45 / 3e-06 AT3G12500 402 / 4e-141 PATHOGENESIS-RELATED 3, basic chitinase (.1) Lus10041828 [exp] 42 / 6e-06 AT3G12500 59 / 8e-12 PATHOGENESIS-RELATED 3, basic chitinase (.1) Lus10014253 [exp] 42 / 2e-05 AT2G43570 46 / 1e-06 "chitinase, putative", chitinase, putative (.1) Lus10006552 [exp] 42 / 2e-05 AT3G04720 244 / 1e-82 HEVEIN-LIKE, pathogenesis-related 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G093700 [exp] 50 / 6e-08 AT3G54420 413 / 3e-147 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1) Potri.019G094000 [exp] 49 / 7e-08 AT3G54420 340 / 2e-118 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1) Potri.019G093800 [exp] 49 / 8e-08 AT3G54420 369 / 8e-130 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1) Potri.013G125100 [exp] 49 / 9e-08 AT3G54420 336 / 1e-116 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1) Potri.019G094100 [exp] 49 / 1e-07 AT3G54420 350 / 3e-122 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1) Potri.019G093900 [exp] 49 / 1e-07 AT3G54420 360 / 3e-126 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1) Potri.013G125000 [exp] 46 / 9e-07 AT3G54420 421 / 1e-150 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1) Potri.009G141700 [exp] 46 / 2e-06 AT3G12500 405 / 3e-142 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.009G142300 [exp] 45 / 2e-06 AT3G12500 340 / 1e-116 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.009G141800 [exp] 44 / 6e-06 AT3G12500 351 / 9e-121 PATHOGENESIS-RELATED 3, basic chitinase (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00187 [flax] [poplar] Chitin_bind_1 Chitin recognition protein
Representative CDS sequence Show only first row Show all	>Lus10020338 pacid=23144161 polypeptide=Lus10020338 locus=Lus10020338.g ID=Lus10020338.BGIv1.0 annot-version=v1.0 ATGGCACCCATTAACGTTCTTAATTATTTCCTGTCTCTCATACTAGTCCTAATAGCGTCGACTAAACTCCAACATTTTGCCGCCGCCGGCACGTCTTTCC GGCTAGTCACGGCAGCCTCCGCGCCCTACAATTCGCCGCCGGCGCCTGTGATGGTAAACCTCACCCACGACGACGGCTGGTACGACCACCCGCACTGCGG ATACCAGTCCCCGAAAGAAACCTGCGCGACGGGATTATGCTGCAGCCGGTTTGGCTACTGTGGGACAAAACCTGAGTATTGCGGCAAGGGCTGCCAAGAC GGCCCCTGTCAAGGCGGCAGCGGCGGCGTGCCACACACTCCTTCGCCGTCTTCGGGAACCCCTTCGCCAGCTAATTATTAA
AA sequence Show only first row Show all	>Lus10020338 pacid=23144161 polypeptide=Lus10020338 locus=Lus10020338.g ID=Lus10020338.BGIv1.0 annot-version=v1.0 MAPINVLNYFLSLILVLIASTKLQHFAAAGTSFRLVTAASAPYNSPPAPVMVNLTHDDGWYDHPHCGYQSPKETCATGLCCSRFGYCGTKPEYCGKGCQD GPCQGGSGGVPHTPSPSSGTPSPANY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G43620			Chitinase family protein (.1)		Lus10020338 [exp]	0	1
AT4G17260			Lactate/malate dehydrogenase f...		Lus10006030 [exp]	3.0	0.6780
AT3G19850			Phototropic-responsive NPH3 fa...		Lus10029070 [exp]	12.0	0.5652
AT4G19810		ChiC	class V chitinase, Glycosyl hy...		Lus10000981 [exp]	15.0	0.5908
					Lus10029472 [exp]	22.6	0.5527
AT2G16730		BGAL13	beta-galactosidase 13, glycosy...		Lus10019784 [exp]	24.4	0.4948
AT2G44760			Domain of unknown function (DU...		Lus10020744 [exp]	29.0	0.5419
					Lus10008153 [exp]	29.5	0.5595
AT1G60410			F-box family protein (.1)		Lus10020292 [exp]	30.6	0.5315
AT5G24860		ATFPF1, FPF1	ARABIDOPSIS FLOWERING PROMOTIN...		Lus10020156 [exp]	37.1	0.5002
					Lus10036275 [exp]	41.2	0.5327

Compare expression of checked genes

Lus10020338 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.