Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G64940 44 / 7e-06 CYP89A6 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) AT3G03470 42 / 4e-05 CYP89A9 "cytochrome P450, family 87, subfamily A, polypeptide 9", cytochrome P450, family 87, subfamily A, polypeptide 9 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009535 [exp] 252 / 2e-88 AT1G64940 55 / 8e-17 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10020353 [exp] 88 / 3e-21 AT1G64940 572 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10028654 [exp] 83 / 2e-19 AT1G64940 562 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10020358 [exp] 69 / 4e-16 AT1G64940 80 / 2e-18 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10010229 [exp] 53 / 8e-09 AT1G64940 574 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10020360 [exp] 52 / 1e-08 AT1G64940 613 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10013067 [exp] 47 / 1e-06 AT1G64940 472 / 4e-163 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10009534 [exp] 40 / 2e-05 AT3G03470 68 / 9e-15 "cytochrome P450, family 87, subfamily A, polypeptide 9", cytochrome P450, family 87, subfamily A, polypeptide 9 (.1) Lus10020354 [exp] 40 / 2e-05 AT3G03470 68 / 9e-15 "cytochrome P450, family 87, subfamily A, polypeptide 9", cytochrome P450, family 87, subfamily A, polypeptide 9 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G079600 [exp] 67 / 6e-14 AT1G64940 575 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Potri.007G087950 [exp] 65 / 3e-13 AT1G64950 642 / 0.0 "cytochrome P450, family 89, subfamily A, polypeptide 5", cytochrome P450, family 89, subfamily A, polypeptide 5 (.1) Potri.007G088018 [exp] 64 / 1e-12 AT1G64940 605 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Potri.007G088154 [exp] 64 / 1e-12 AT1G64950 639 / 0.0 "cytochrome P450, family 89, subfamily A, polypeptide 5", cytochrome P450, family 89, subfamily A, polypeptide 5 (.1) Potri.007G088086 [exp] 63 / 2e-12 AT1G64950 636 / 0.0 "cytochrome P450, family 89, subfamily A, polypeptide 5", cytochrome P450, family 89, subfamily A, polypeptide 5 (.1) Potri.013G076600 [exp] 48 / 3e-07 AT1G64940 578 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Potri.013G076700 [exp] 47 / 5e-07 AT1G64940 592 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Potri.003G104600 [exp] 44 / 1e-05 AT1G64940 455 / 2e-156 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Potri.008G099100 [exp] 40 / 0.0002 AT1G64940 540 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Potri.002G025800 [exp] 39 / 0.0003 AT4G31500 490 / 3e-170 SUPERROOT 2, RUNT 1, RED ELONGATED 1, "cytochrome P450, family 83, subfamily B, polypeptide 1", ALTERED TRYPTOPHAN REGULATION 4, cytochrome P450, family 83, subfamily B, polypeptide 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020355 pacid=23144054 polypeptide=Lus10020355 locus=Lus10020355.g ID=Lus10020355.BGIv1.0 annot-version=v1.0 ATGGATGATTTATGGTTCCTTATCTTAGTCTCTCTCCCAATTTCCTTCCTTGTCATTAACCTTTTCTCGAACTCCTTCGCCGGGACACCATCCCTCCCGC CGGGCCCCGCCTGGCTACCATTCTGCTCTGGACTTGAACCGGTCCTTCGTTCCCTCCACGCTAAACACGGCTTTGCCGTCACGCTCCACATCGGCAACCG GCCTGTAATTCTTTGCAGATCCAGCCGCCGCCCATCGTTCTTTGGTCCAAAACAGTACCGTCTTCTCCGACGGTCTGGATTCTCCAATGTGGCAAATCCT GAGCTCCGATATGCACACAATTGGCGCCTCGCCTTATGGCGCGACATGGAGGCTCCTCCATCGCAACCTCACCTCTGA
AA sequence Show only first row Show all	>Lus10020355 pacid=23144054 polypeptide=Lus10020355 locus=Lus10020355.g ID=Lus10020355.BGIv1.0 annot-version=v1.0 MDDLWFLILVSLPISFLVINLFSNSFAGTPSLPPGPAWLPFCSGLEPVLRSLHAKHGFAVTLHIGNRPVILCRSSRRPSFFGPKQYRLLRRSGFSNVANP ELRYAHNWRLALWRDMEAPPSQPHL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Lus10020355 [exp]	0	1
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Lus10009535 [exp]	1.0	0.9479
AT5G58050		GDPDL6, SVL4	Glycerophosphodiester phosphod...		Lus10000055 [exp]	9.8	0.7905
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Lus10020356 [exp]	10.2	0.7540
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Lus10009536 [exp]	27.5	0.6975
AT3G52320			F-box and associated interacti...		Lus10038541 [exp]	32.5	0.7545
AT5G19410		ABCG23	ATP-binding cassette G23, ABC-...		Lus10017683 [exp]	40.5	0.7778
AT5G58170		GDPDL7, SVL5	Glycerophosphodiester phosphod...		Lus10019606 [exp]	43.0	0.7500
AT5G56040			Leucine-rich receptor-like pro...		Lus10005847 [exp]	48.2	0.7596
AT5G36930			Disease resistance protein (TI...		Lus10024886 [exp]	56.2	0.7684
AT4G30310			FGGY family of carbohydrate ki...		Lus10001312 [exp]	58.5	0.7631

Compare expression of checked genes

Lus10020355 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.