Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G03470 67 / 1e-12 CYP89A9 "cytochrome P450, family 87, subfamily A, polypeptide 9", cytochrome P450, family 87, subfamily A, polypeptide 9 (.1) AT1G64940 55 / 2e-08 CYP89A6 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) AT1G64950 54 / 3e-08 CYP89A5 "cytochrome P450, family 89, subfamily A, polypeptide 5", cytochrome P450, family 89, subfamily A, polypeptide 5 (.1) AT1G64930 54 / 4e-08 CYP89A7 "cytochrome P450, family 87, subfamily A, polypeptide 7", cytochrome P450, family 87, subfamily A, polypeptide 7 (.1) AT1G64900 54 / 5e-08 CYP89A2 "cytochrome P450, family 89, subfamily A, polypeptide 2", cytochrome P450, family 89, subfamily A, polypeptide 2 (.1) AT5G61320 53 / 7e-08 CYP89A3 "cytochrome P450, family 89, subfamily A, polypeptide 3", cytochrome P450, family 89, subfamily A, polypeptide 3 (.1) AT2G12190 52 / 2e-07 CYP89A4 Cytochrome P450 superfamily protein (.1) AT1G11600 46 / 2e-05 CYP77B1 "cytochrome P450, family 77, subfamily B, polypeptide 1", cytochrome P450, family 77, subfamily B, polypeptide 1 (.1) AT5G04630 45 / 3e-05 CYP77A9 "cytochrome P450, family 77, subfamily A, polypeptide 9", cytochrome P450, family 77, subfamily A, polypeptide 9 (.1) AT1G58807 42 / 0.0003 Disease resistance protein (CC-NBS-LRR class) family (.1), Disease resistance protein (CC-NBS-LRR class) family (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004126 [exp] 147 / 6e-40 AT3G14470 353 / 6e-106 NB-ARC domain-containing disease resistance protein (.1) Lus10002609 [exp] 134 / 2e-35 AT3G14470 364 / 9e-110 NB-ARC domain-containing disease resistance protein (.1) Lus10022900 [exp] 128 / 4e-33 AT3G14470 350 / 2e-104 NB-ARC domain-containing disease resistance protein (.1) Lus10003571 [exp] 121 / 6e-31 AT3G14470 363 / 6e-110 NB-ARC domain-containing disease resistance protein (.1) Lus10004127 [exp] 107 / 3e-26 AT3G14470 350 / 5e-105 NB-ARC domain-containing disease resistance protein (.1) Lus10022792 [exp] 97 / 2e-22 AT3G14470 343 / 7e-102 NB-ARC domain-containing disease resistance protein (.1) Lus10011856 [exp] 92 / 2e-22 AT3G14460 76 / 5e-16 LRR and NB-ARC domains-containing disease resistance protein (.1) Lus10032782 [exp] 90 / 9e-22 AT3G14460 57 / 1e-09 LRR and NB-ARC domains-containing disease resistance protein (.1) Lus10020353 [exp] 77 / 6e-16 AT1G64940 572 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G088154 [exp] 67 / 3e-12 AT1G64950 639 / 0.0 "cytochrome P450, family 89, subfamily A, polypeptide 5", cytochrome P450, family 89, subfamily A, polypeptide 5 (.1) Potri.007G088086 [exp] 66 / 3e-12 AT1G64950 636 / 0.0 "cytochrome P450, family 89, subfamily A, polypeptide 5", cytochrome P450, family 89, subfamily A, polypeptide 5 (.1) Potri.007G087950 [exp] 66 / 3e-12 AT1G64950 642 / 0.0 "cytochrome P450, family 89, subfamily A, polypeptide 5", cytochrome P450, family 89, subfamily A, polypeptide 5 (.1) Potri.007G088018 [exp] 66 / 3e-12 AT1G64940 605 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Potri.008G099100 [exp] 66 / 4e-12 AT1G64940 540 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Potri.005G079600 [exp] 65 / 8e-12 AT1G64940 575 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Potri.013G076700 [exp] 62 / 7e-11 AT1G64940 592 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Potri.013G076600 [exp] 62 / 1e-10 AT1G64940 578 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Potri.012G121851 [exp] 61 / 2e-10 AT3G14470 348 / 2e-105 NB-ARC domain-containing disease resistance protein (.1) Potri.001G330501 [exp] 60 / 4e-10 AT1G64940 569 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020361 pacid=23144166 polypeptide=Lus10020361 locus=Lus10020361.g ID=Lus10020361.BGIv1.0 annot-version=v1.0 ATGATGTCATTTGGTGCTCGAATGAGGATGTGTCTAGCGTATAGATTGGTATTGCTGCATATAGAGTATTTCCTAGTGAATTTGGTTTGGAGTTTCGAGT GGAAGGTCGTCCCCGACAAGAGAGTTGATCTGTTGGGAGGTGTTATGAAGAATCCATTGAAGGTCGGCGGCAAGACCATCCACCAAATTGGAACAATACG AGTACAATGGTGCTTCCTTATCTCCGAGCTGGATGGTGAAGATTGCTACCAGGTGAAGTATCTACCTCCTTTAGGTGGTCTGCCGTCTCTTGAAGAACTA TCATTCTCTACAATGTGGAATGTAAAGAAAGTAGGTGTTGAGTTTCTTGGACAACAGCCAGAGGAAATTGGAACAATATTTCCAAGGTTGTCGGTGCTGA AATTTCAAGTGTTGTGGAACTGGGAAGAGTGGGATGATACGATGTTATTGTCACCGTCAGTGATGCCTCGGCTAAGTTGCTTGATTTTGACGGACTGCAG TCAGCTAAAGAAGTTGCCCGATGCAATTCTCCGGAAACCGACACTCCAAAGGATAGAAGTGAATTATTGCTACACTGTGAAAAGTAGATTGCATCGGGAA GAGGAGGACAATGTGCCTCCTGAAATTGTGCTTGGTAAAGCACGGAACAACATCGCTCACATCCCCACCATCATTACTAATGATTTCGACGTTCGAACGA GCGAGCTCGCGTTCGAAGTTACTAATGACAGTGACAACATCTTCGCTAGTGCCGGTGAATACTTCATTTTTTCTTCGCTGGACCAAGTTAACTATACGAA ATAA
AA sequence Show only first row Show all	>Lus10020361 pacid=23144166 polypeptide=Lus10020361 locus=Lus10020361.g ID=Lus10020361.BGIv1.0 annot-version=v1.0 MMSFGARMRMCLAYRLVLLHIEYFLVNLVWSFEWKVVPDKRVDLLGGVMKNPLKVGGKTIHQIGTIRVQWCFLISELDGEDCYQVKYLPPLGGLPSLEEL SFSTMWNVKKVGVEFLGQQPEEIGTIFPRLSVLKFQVLWNWEEWDDTMLLSPSVMPRLSCLILTDCSQLKKLPDAILRKPTLQRIEVNYCYTVKSRLHRE EEDNVPPEIVLGKARNNIAHIPTIITNDFDVRTSELAFEVTNDSDNIFASAGEYFIFSSLDQVNYTK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G03470		CYP89A9	"cytochrome P450, family 87, s...		Lus10020361 [exp]	0	1
AT2G39350		ABCG1	ATP-binding cassette G1, ABC-2...		Lus10025149 [exp]	1.4	0.9347
AT2G06090			Plant self-incompatibility pro...		Lus10029389 [exp]	2.0	0.9347
AT1G68320	MYB	BW62C, BW62B, A...	myb domain protein 62 (.1)		Lus10041435 [exp]	7.1	0.6880
AT5G67440		MEL2, NPY3	NAKED PINS IN YUC MUTANTS 3, M...		Lus10025193 [exp]	7.5	0.8457
AT2G40170		GEA6, ATEM6	LATE EMBRYOGENESIS ABUNDANT 6,...		Lus10030394 [exp]	8.5	0.8083
AT1G47550		SEC3A	exocyst complex component sec3...		Lus10001022 [exp]	8.7	0.8457
					Lus10035026 [exp]	9.7	0.8457
AT4G14130		XTR7, XTH15	xyloglucan endotransglycosylas...		Lus10008888 [exp]	10.7	0.8457
					Lus10009177 [exp]	11.5	0.8457
AT1G54130		AT-RSH3, RSH3, ...	RELA/SPOT homolog 3 (.1)		Lus10011252 [exp]	12.3	0.8457

Compare expression of checked genes

Lus10020361 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.