Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G09815 87 / 4e-23 POLD4 polymerase delta 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009538 [exp] 181 / 8e-61 AT1G09815 96 / 7e-27 polymerase delta 4 (.1) Lus10024978 [exp] 122 / 5e-37 AT1G09815 129 / 8e-40 polymerase delta 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G076400 [exp] 91 / 8e-25 AT1G09815 154 / 1e-49 polymerase delta 4 (.1) Potri.019G042900 [exp] 85 / 1e-22 AT1G09815 152 / 8e-49 polymerase delta 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04081 [flax] [poplar] DNA_pol_delta_4 DNA polymerase delta, subunit 4
Representative CDS sequence Show only first row Show all	>Lus10020362 pacid=23144063 polypeptide=Lus10020362 locus=Lus10020362.g ID=Lus10020362.BGIv1.0 annot-version=v1.0 ATGATGAAGTCGTACTACAAGCAAAAGAAGACTAACCGTGCTTCCGACGTCGGCAAGCCTTCACCGTCGTCCAAGTCAATCAAGAAGAAATCGCCGGCGG TACCTCAACCGATCTCTCCTCGCCACGACGACGAAGTGGTGGAGAAGAGCGAGCAGGTGCTGAGGGAGTTTGACATGAACATGGCGTACGGACCTTGCAT CGGAATGACGAGATCGGCTCGGTGGGAGCGAGCTCATCGCCTGGGATTGAATCCTTCCGGCGAGATTAAGAATCTACTGGATGCTGGAGAGGGAAATGCG CAGAGCGTCTGGGATGGCCGTGTCTGA
AA sequence Show only first row Show all	>Lus10020362 pacid=23144063 polypeptide=Lus10020362 locus=Lus10020362.g ID=Lus10020362.BGIv1.0 annot-version=v1.0 MMKSYYKQKKTNRASDVGKPSPSSKSIKKKSPAVPQPISPRHDDEVVEKSEQVLREFDMNMAYGPCIGMTRSARWERAHRLGLNPSGEIKNLLDAGEGNA QSVWDGRV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G09815		POLD4	polymerase delta 4 (.1)		Lus10020362 [exp]	0	1
AT2G47620		CHB1, ATSWI3A	SWITCH/sucrose nonfermenting 3...		Lus10032555 [exp]	3.2	0.8289
AT5G08420			RNA-binding KH domain-containi...		Lus10026187 [exp]	5.8	0.8383
AT5G11010			Pre-mRNA cleavage complex II p...		Lus10036655 [exp]	12.7	0.8245
AT2G30620			winged-helix DNA-binding trans...		Lus10022001 [exp]	12.8	0.8117
AT3G51290			Protein of unknown function (D...		Lus10013564 [exp]	14.9	0.7580
AT3G02080			Ribosomal protein S19e family ...		Lus10033532 [exp]	19.7	0.8186
AT1G26340		B5 #6, B5#6, AT...	ARABIDOPSIS CYTOCHROME B5 ISOF...		Lus10000651 [exp]	25.2	0.8049
AT5G03500			Mediator complex, subunit Med7...		Lus10029326 [exp]	25.5	0.7710
AT5G64680			unknown protein		Lus10018951 [exp]	26.9	0.8103
					Lus10030329 [exp]	27.0	0.7470

Compare expression of checked genes

Lus10020362 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.