Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30390 115 / 3e-35 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009554 [exp] 86 / 4e-21 AT1G65090 126 / 9e-34 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G051850 [exp] 125 / 6e-39 AT4G30390 109 / 2e-32 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020378 pacid=23144187 polypeptide=Lus10020378 locus=Lus10020378.g ID=Lus10020378.BGIv1.0 annot-version=v1.0 ATGAGAACCGGCCAGCCTCCTCCATCTCTGCTTTCTCTCGCCATTGACGCATCTGTGTTTCACCTCTCCGCCTTCACCGATCTCTCCCCTCTCCCCGATC ACATTCTCCTCGATCTCTTCCTGAGAACGTTGAGAGCTGGAAAGCTGAACGAGAAAGTTCTGAAGCTTTTCTTGGCAACAGGCAAAGAAGAGGTCTTAGC ATTCATTCAAACGCTTAACATTCGACATATCCTCACTCCCGTCCTTCCTACCAGATGTTCTGAGAAATTCTGA
AA sequence Show only first row Show all	>Lus10020378 pacid=23144187 polypeptide=Lus10020378 locus=Lus10020378.g ID=Lus10020378.BGIv1.0 annot-version=v1.0 MRTGQPPPSLLSLAIDASVFHLSAFTDLSPLPDHILLDLFLRTLRAGKLNEKVLKLFLATGKEEVLAFIQTLNIRHILTPVLPTRCSEKF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G30390			unknown protein		Lus10020378 [exp]	0	1
AT3G03050		RHD7, ATCSLD3, ...	ROOT HAIR DEFECTIVE 7, KOJAK, ...		Lus10009248 [exp]	8.3	0.8447
AT1G76240			Arabidopsis protein of unknown...		Lus10012275 [exp]	10.9	0.8097
AT5G66920		SKS17	SKU5 similar 17 (.1)		Lus10022465 [exp]	13.1	0.8059
AT3G17440		ATNPSN13, NPSN1...	novel plant snare 13 (.1.2)		Lus10018338 [exp]	13.8	0.8291
AT5G26667		PYR6	P-loop containing nucleoside t...		Lus10033733 [exp]	13.9	0.8133
AT5G26667		PYR6	P-loop containing nucleoside t...		Lus10019509 [exp]	15.3	0.8178
AT3G08670			unknown protein		Lus10025209 [exp]	16.1	0.8199
AT1G47380			Protein phosphatase 2C family ...		Lus10006485 [exp]	16.3	0.7979
AT5G11710			ENTH/VHS family protein (.1)		Lus10005498 [exp]	17.5	0.8195
AT2G43240			Nucleotide-sugar transporter f...		Lus10025486 [exp]	21.4	0.7870

Compare expression of checked genes

Lus10020378 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.