Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G07490 130 / 1e-40 AtCML3, AGD11 calmodulin-like 3, ARF-GAP domain 11 (.1) AT4G12860 126 / 4e-39 UNE14 unfertilized embryo sac 14, EF hand calcium-binding protein family (.1) AT1G05990 122 / 1e-37 RHS1 ,RHS2 ROOT HAIR SPECIFIC 1, EF hand calcium-binding protein family (.1) AT4G03290 112 / 9e-34 EF hand calcium-binding protein family (.1) AT2G43290 114 / 1e-33 MSS3 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1) AT3G59440 107 / 6e-31 Calcium-binding EF-hand family protein (.1) AT5G37770 76 / 6e-19 CML24, TCH2 TOUCH 2, CALMODULIN-LIKE 24, EF hand calcium-binding protein family (.1) AT1G73630 70 / 7e-17 EF hand calcium-binding protein family (.1) AT4G20780 70 / 2e-16 CML42 calmodulin like 42 (.1) AT5G44460 70 / 2e-16 CML43 calmodulin like 43 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009564 [exp] 149 / 3e-48 AT3G07490 233 / 7e-80 calmodulin-like 3, ARF-GAP domain 11 (.1) Lus10038088 [exp] 99 / 3e-27 AT3G07490 150 / 7e-46 calmodulin-like 3, ARF-GAP domain 11 (.1) Lus10006644 [exp] 99 / 3e-27 AT3G07490 148 / 3e-45 calmodulin-like 3, ARF-GAP domain 11 (.1) Lus10027701 [exp] 97 / 9e-27 AT2G43290 153 / 2e-46 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1) Lus10039986 [exp] 77 / 3e-19 AT3G07490 132 / 3e-39 calmodulin-like 3, ARF-GAP domain 11 (.1) Lus10012199 [exp] 72 / 5e-17 AT5G39670 131 / 3e-38 Calcium-binding EF-hand family protein (.1) Lus10009059 [exp] 71 / 5e-17 AT1G18210 197 / 3e-65 Calcium-binding EF-hand family protein (.1.2) Lus10018012 [exp] 71 / 5e-17 AT1G18210 195 / 2e-64 Calcium-binding EF-hand family protein (.1.2) Lus10007536 [exp] 70 / 3e-16 AT5G39670 131 / 2e-38 Calcium-binding EF-hand family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G029700 [exp] 136 / 3e-42 AT3G07490 192 / 1e-62 calmodulin-like 3, ARF-GAP domain 11 (.1) Potri.007G128600 [exp] 134 / 3e-41 AT2G43290 218 / 3e-72 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1) Potri.002G239100 [exp] 132 / 3e-41 AT3G07490 248 / 8e-86 calmodulin-like 3, ARF-GAP domain 11 (.1) Potri.018G127100 [exp] 91 / 4e-24 AT3G07490 132 / 6e-39 calmodulin-like 3, ARF-GAP domain 11 (.1) Potri.006G065900 [exp] 89 / 2e-23 AT3G07490 131 / 1e-38 calmodulin-like 3, ARF-GAP domain 11 (.1) Potri.017G126200 [exp] 76 / 3e-19 AT1G66400 155 / 5e-49 calmodulin like 23 (.1) Potri.002G077300 [exp] 76 / 4e-19 AT1G21550 123 / 3e-36 Calcium-binding EF-hand family protein (.1) Potri.004G089400 [exp] 76 / 6e-19 AT1G66400 157 / 7e-50 calmodulin like 23 (.1) Potri.005G183300 [exp] 72 / 9e-18 AT1G21550 136 / 1e-41 Calcium-binding EF-hand family protein (.1) Potri.012G048200 [exp] 71 / 2e-17 AT1G18210 188 / 8e-62 Calcium-binding EF-hand family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [flax] [poplar] EF_hand PF00036 [flax] [poplar] EF-hand_1 EF hand
Representative CDS sequence Show only first row Show all	>Lus10020389 pacid=23144188 polypeptide=Lus10020389 locus=Lus10020389.g ID=Lus10020389.BGIv1.0 annot-version=v1.0 ATGCGGGAGGCGTTCAACGTTTTCGACCAGAACGGCGACGGTTTCATCACCGTCGACGAGCTCCGGTCCGTGCTGGCGTCGCTGGGCCTGAAGCAAGGCC GCACCGTCGAGGACTGCCGGAGGATGATCATGAAGGTCGACGTCGACGGCGACGGGATGGTCAATTTCAAGGAGTTCAAGCAGATGATGAAAGGTGGCGG GTTCGCTGCTCTCAGCTCCAGCTGA
AA sequence Show only first row Show all	>Lus10020389 pacid=23144188 polypeptide=Lus10020389 locus=Lus10020389.g ID=Lus10020389.BGIv1.0 annot-version=v1.0 MREAFNVFDQNGDGFITVDELRSVLASLGLKQGRTVEDCRRMIMKVDVDGDGMVNFKEFKQMMKGGGFAALSSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G07490		AtCML3, AGD11	calmodulin-like 3, ARF-GAP dom...		Lus10020389 [exp]	0	1
AT2G43290		MSS3	multicopy suppressors of snf4 ...		Lus10027701 [exp]	1.4	0.9164
AT3G01400			ARM repeat superfamily protein...		Lus10007738 [exp]	3.5	0.8881
AT5G56150		UBC30	ubiquitin-conjugating enzyme 3...		Lus10016670 [exp]	7.1	0.8766
AT1G01550		BPS1	BYPASS 1, Protein of unknown f...		Lus10039581 [exp]	8.5	0.8763
AT3G03280			unknown protein		Lus10013490 [exp]	10.4	0.8899
AT3G03280			unknown protein		Lus10007960 [exp]	11.0	0.8913
AT5G51190	AP2_ERF		Integrase-type DNA-binding sup...		Lus10042996 [exp]	13.5	0.8589
AT2G46550			unknown protein		Lus10023163 [exp]	13.7	0.8551
					Lus10000510 [exp]	13.8	0.8676
AT1G55760			BTB/POZ domain-containing prot...		Lus10027101 [exp]	16.6	0.8270

Compare expression of checked genes

Lus10020389 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.