Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G63670 205 / 4e-70 SPT42 SPT4 homolog 2 (.1.2) AT5G08565 204 / 1e-69 Transcription initiation Spt4-like protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009573 [exp] 231 / 5e-74 AT5G17010 691 / 0.0 Major facilitator superfamily protein (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G255000 [exp] 213 / 4e-73 AT5G63670 212 / 6e-73 SPT4 homolog 2 (.1.2) Potri.008G002400 [exp] 210 / 4e-72 AT5G63670 210 / 5e-72 SPT4 homolog 2 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF06093 [flax] [poplar] Spt4 Spt4/RpoE2 zinc finger
Representative CDS sequence Show only first row Show all	>Lus10020394 pacid=23144144 polypeptide=Lus10020394 locus=Lus10020394.g ID=Lus10020394.BGIv1.0 annot-version=v1.0 ATGGGAAGTAGCCACCAGCCGGCTCAGGCGGCACAAATTCCGACGAGCTTCGGCCACGAACTGCGAGCATGTCTCCGTTGCCGCCTTGTCAAGACTTACG ACCAGTTCAGAGATTCCGGGTGCGAGAACTGCCCGTTTTTCAAGCTGGAGGAAGATCATGAGCGCGTTGTCGACTGCACGACTCCCAATTTCAACGGGGT GATTTCTGTTATGGATCCAACGAGAAGCTGGGCAGCTCGATGGTTGAGAATTGCAAGATTCGTCCCTGGTTGCTACACTCTTGCGGTTTCAGAGGCTCTC TCCGAGGACATGCAGCAATTATGCCAAGAAGAGCGAGTGCTCTACGTCCCTCCGAAGACGTACAAATAG
AA sequence Show only first row Show all	>Lus10020394 pacid=23144144 polypeptide=Lus10020394 locus=Lus10020394.g ID=Lus10020394.BGIv1.0 annot-version=v1.0 MGSSHQPAQAAQIPTSFGHELRACLRCRLVKTYDQFRDSGCENCPFFKLEEDHERVVDCTTPNFNGVISVMDPTRSWAARWLRIARFVPGCYTLAVSEAL SEDMQQLCQEERVLYVPPKTYK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G63670		SPT42	SPT4 homolog 2 (.1.2)		Lus10020394 [exp]	0	1
AT1G07130		STN1, ATSTN1	Nucleic acid-binding, OB-fold-...		Lus10022075 [exp]	25.4	0.6643
AT2G04520			Nucleic acid-binding, OB-fold-...		Lus10033806 [exp]	25.5	0.7050
AT3G26210		CYP71B23	"cytochrome P450, family 71, s...		Lus10017678 [exp]	47.1	0.5815
AT2G45880	BZR	BAM7, BMY4	BETA-AMYLASE 4, beta-amylase 7...		Lus10017820 [exp]	52.4	0.6900
AT4G26055			unknown protein		Lus10011865 [exp]	66.8	0.6001
AT3G02100			UDP-Glycosyltransferase superf...		Lus10015752 [exp]	104.2	0.5953
					Lus10034896 [exp]	113.0	0.6467
AT2G28430			unknown protein		Lus10022580 [exp]	117.3	0.6486
					Lus10041761 [exp]	124.7	0.6132
					Lus10037718 [exp]	131.8	0.5948

Compare expression of checked genes

Lus10020394 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.