Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020194 [exp] 57 / 2e-11 ND / Lus10006041 [exp] 51 / 9e-09 ND / Lus10030094 [exp] 46 / 4e-07 ND / Lus10003156 [exp] 44 / 8e-06 AT3G16030 556 / 0.0 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) Lus10022417 [exp] 40 / 7e-05 AT3G49210 68 / 1e-13 O-acyltransferase (WSD1-like) family protein (.1) Lus10009583 [exp] 38 / 0.0003 AT4G23310 164 / 2e-47 cysteine-rich RLK (RECEPTOR-like protein kinase) 23 (.1) Lus10009393 [exp] 0 / 1 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020402 pacid=23144097 polypeptide=Lus10020402 locus=Lus10020402.g ID=Lus10020402.BGIv1.0 annot-version=v1.0 ATGTTGTCCAATGAAACATTAGAGCTTCTTAATCCGAAACAGCCTGCATTCTTCATCGGTGGTGTTGCGAACAATCATGCTCCGTTGGTAGCACAGGATC CAAATGTGAGGACAGACGGTCAGATAGGAAGGAAGCTCTGCAATAATAGCCCCTCCGGCAACACATCGGGTGCACCTCCTAAAGATACGGGAAAGTACGG CCTCAACATCCCCCTCAAGATCAACCTGCCAGACATTATGACGAAAACACCAAACACACCCGTCACGGACGGCCAGAAGCTTCATAACATATGGGGTCAA GAAGCTCCACTACGCCATCTTAATTAA
AA sequence Show only first row Show all	>Lus10020402 pacid=23144097 polypeptide=Lus10020402 locus=Lus10020402.g ID=Lus10020402.BGIv1.0 annot-version=v1.0 MLSNETLELLNPKQPAFFIGGVANNHAPLVAQDPNVRTDGQIGRKLCNNSPSGNTSGAPPKDTGKYGLNIPLKINLPDIMTKTPNTPVTDGQKLHNIWGQ EAPLRHLN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10020402 [exp]	0	1
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10027891 [exp]	5.7	1.0000
					Lus10026042 [exp]	8.7	1.0000
					Lus10027530 [exp]	9.3	1.0000
					Lus10002313 [exp]	11.0	1.0000
AT5G56790			Protein kinase superfamily pro...		Lus10000773 [exp]	11.3	1.0000
AT4G35500			Protein kinase superfamily pro...		Lus10016690 [exp]	11.7	1.0000
					Lus10008789 [exp]	12.6	1.0000
AT1G35720		ATOXY5, ANNAT1	annexin 1 (.1)		Lus10036470 [exp]	13.8	1.0000
AT1G69530		ATHEXPALPHA1.2,...	EXPANSIN 1, expansin A1 (.1.2....		Lus10003438 [exp]	13.9	1.0000
					Lus10006296 [exp]	15.2	1.0000

Compare expression of checked genes

Lus10020402 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.