Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009587 [exp] 129 / 3e-40 AT3G07425 42 / 5e-06 unknown protein Lus10038229 [exp] 44 / 6e-07 AT3G07425 52 / 3e-10 unknown protein Lus10025871 [exp] 43 / 3e-06 AT3G07425 50 / 4e-09 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G250100 [exp] 58 / 3e-12 AT3G07425 49 / 6e-09 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020406 pacid=23144135 polypeptide=Lus10020406 locus=Lus10020406.g ID=Lus10020406.BGIv1.0 annot-version=v1.0 ATGCTGAAGAGACCCATAATCACAGTCACCATGTCCATGGCGTCAAGCTCCAACAACGTCCTGGCCGCACTATGCCGGCCGCCTCGGCCGCGACGATTGA GGAGGCGTAGGGCCGGCACGATAAGGCTCGGGAGCCGCCGGCGAGGACTCGTCTGGCTTGCAACACGGCCGCCGGTCGTCCAATGGGGTGCAATGGCCAG AATGCTGAAGAGGATTTTGATTGATTTAGCTCCTAATTGTTCTGTTAGTTTTGATGCTTATTACCGGCTTTTGCCGTTCTTACGCCCTCAGAGTTTTCCC CTTTGTTGA
AA sequence Show only first row Show all	>Lus10020406 pacid=23144135 polypeptide=Lus10020406 locus=Lus10020406.g ID=Lus10020406.BGIv1.0 annot-version=v1.0 MLKRPIITVTMSMASSSNNVLAALCRPPRPRRLRRRRAGTIRLGSRRRGLVWLATRPPVVQWGAMARMLKRILIDLAPNCSVSFDAYYRLLPFLRPQSFP LC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G07425			unknown protein		Lus10020406 [exp]	0	1
AT1G70780			unknown protein		Lus10019143 [exp]	7.4	0.9039
AT1G23100			GroES-like family protein (.1)		Lus10036055 [exp]	8.4	0.8893
AT5G24080			Protein kinase superfamily pro...		Lus10039315 [exp]	10.2	0.8867
AT5G40810			Cytochrome C1 family (.1.2)		Lus10041577 [exp]	14.4	0.9019
AT4G30320			CAP (Cysteine-rich secretory p...		Lus10006980 [exp]	16.6	0.9004
AT4G39520			GTP-binding protein-related (....		Lus10005800 [exp]	16.7	0.9027
AT2G46170			Reticulon family protein (.1.2...		Lus10036405 [exp]	16.9	0.8846
AT5G62270			unknown protein		Lus10021682 [exp]	19.3	0.8698
					Lus10017269 [exp]	27.0	0.8895
AT2G24400			SAUR-like auxin-responsive pro...		Lus10035716 [exp]	27.8	0.9000

Compare expression of checked genes

Lus10020406 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.