Lus10020408 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G12970 89 / 6e-24 EPFL9, STOMAGEN stomagen (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009589 155 / 2e-50 AT4G12970 87 / 3e-24 stomagen (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G249901 94 / 8e-26 AT4G12970 103 / 6e-30 stomagen (.1)
PFAM info
Representative CDS sequence
>Lus10020408 pacid=23144113 polypeptide=Lus10020408 locus=Lus10020408.g ID=Lus10020408.BGIv1.0 annot-version=v1.0
ATGGCTTCTGCTACTTCCATTCAACTGTACCATTCATTCTTCTTATTACTCTTCTTCTTCTTCTTCTCTGCTGCTGTCCTTGATTCCTCAGCTTCTGCCA
CCCTTCAAGGACTCATAAGTCATCATGGCCATGATGTGAAGAACCCTGCAATGCCACAACACAAGCTTCACTCATCCAAGGAGTATGAGAAGAGTGAAGA
AGGGACCGTAATCAAAGGAAGAAGCTATGGGAGGAGGCTTCTGATAGGGTCAATGGCTCCAATATGTACATACAATGAATGCAGAGGATGCAAGTTGTAC
ACCAAGAAGTGTTGGGCAGAGCAAGTCCCTGTTGAAGGCAATGACCCTATCAACAGTGCTTATCACTACAAATGTGTTTGCCATAGGTGA
AA sequence
>Lus10020408 pacid=23144113 polypeptide=Lus10020408 locus=Lus10020408.g ID=Lus10020408.BGIv1.0 annot-version=v1.0
MASATSIQLYHSFFLLLFFFFFSAAVLDSSASATLQGLISHHGHDVKNPAMPQHKLHSSKEYEKSEEGTVIKGRSYGRRLLIGSMAPICTYNECRGCKLY
TKKCWAEQVPVEGNDPINSAYHYKCVCHR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G12970 EPFL9, STOMAGEN stomagen (.1) Lus10020408 0 1
AT1G32450 NRT1.5 nitrate transporter 1.5 (.1) Lus10011058 4.1 0.8827
AT2G28780 unknown protein Lus10024409 4.9 0.8812
AT5G02750 SGR9 SHOOT GRAVITROPISM 9, RING/U-b... Lus10003992 6.0 0.8738
AT3G43660 Vacuolar iron transporter (VIT... Lus10025685 7.9 0.8809
AT2G39210 Major facilitator superfamily ... Lus10014640 10.2 0.8093
AT4G37650 GRAS SGR7, SHR SHORT ROOT, SHOOT GRAVITROPISM... Lus10025200 10.7 0.8559
AT4G21500 unknown protein Lus10011256 12.0 0.8405
AT2G02240 MEE66 maternal effect embryo arrest ... Lus10018171 14.0 0.8376
AT2G44730 Trihelix Alcohol dehydrogenase transcri... Lus10000963 14.1 0.8327
AT4G33840 Glycosyl hydrolase family 10 p... Lus10014642 14.4 0.8444

Lus10020408 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.