Lus10020410 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G18100 224 / 4e-77 Ribosomal protein L32e (.1)
AT5G46430 221 / 5e-76 Ribosomal protein L32e (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031699 246 / 1e-85 AT4G18100 240 / 2e-83 Ribosomal protein L32e (.1)
Lus10009591 246 / 1e-84 AT4G18100 243 / 4e-83 Ribosomal protein L32e (.1)
Lus10012195 243 / 1e-84 AT4G18100 246 / 1e-85 Ribosomal protein L32e (.1)
Lus10007541 243 / 1e-84 AT4G18100 246 / 1e-85 Ribosomal protein L32e (.1)
Lus10011970 242 / 5e-84 AT4G18100 246 / 1e-85 Ribosomal protein L32e (.1)
Lus10004589 241 / 1e-83 AT4G18100 247 / 4e-86 Ribosomal protein L32e (.1)
Lus10031120 247 / 3e-82 AT3G22660 289 / 9e-96 rRNA processing protein-related (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G353900 230 / 1e-79 AT4G18100 227 / 4e-78 Ribosomal protein L32e (.1)
Potri.014G191000 230 / 1e-79 AT4G18100 227 / 4e-78 Ribosomal protein L32e (.1)
Potri.002G249000 228 / 2e-78 AT4G18100 226 / 5e-78 Ribosomal protein L32e (.1)
Potri.011G078200 225 / 2e-77 AT4G18100 225 / 2e-77 Ribosomal protein L32e (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01655 Ribosomal_L32e Ribosomal protein L32
Representative CDS sequence
>Lus10020410 pacid=23144145 polypeptide=Lus10020410 locus=Lus10020410.g ID=Lus10020410.BGIv1.0 annot-version=v1.0
ATGGCGGTTCCTTTGCTGACGAAGAAGATCATCAAGAAGAGGGTCAAGCAGTTCAAGAGGCCCCAGAGTGACCGCAAGCACTGCGTCAAGGAAAACTGGA
GGAGGCCTAAGGGTATTGACTCAAGGGTCAGGAGGAAGTTCAAGGGTGTGACTTTGATGCCCAATATAGGTTACGGCTCAGACAAGAAGACCAGACACTA
TCTCCCCAACGGCTTCAAGAAGTTTGTCGTCCACAACGTCAAGGAGCTTGAGGTTCTGATGATGCACAACAGGACCTACTGTGCCGAGATTGCACACGAT
GTTTCTACCAGGAAGAGGAAGGACATTGTCGAGCGTGCAGCGCAGTTGGACATCGTGGTAACCAACAAGCTTGCCAGGCTCAGGAGCCAAGAGGATGAGT
AG
AA sequence
>Lus10020410 pacid=23144145 polypeptide=Lus10020410 locus=Lus10020410.g ID=Lus10020410.BGIv1.0 annot-version=v1.0
MAVPLLTKKIIKKRVKQFKRPQSDRKHCVKENWRRPKGIDSRVRRKFKGVTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVKELEVLMMHNRTYCAEIAHD
VSTRKRKDIVERAAQLDIVVTNKLARLRSQEDE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G18100 Ribosomal protein L32e (.1) Lus10020410 0 1
AT5G27850 Ribosomal protein L18e/L15 sup... Lus10041264 1.0 0.9800
AT5G10360 RPS6B, EMB3010 Ribosomal protein small subuni... Lus10027260 1.7 0.9666
AT4G18100 Ribosomal protein L32e (.1) Lus10009591 2.0 0.9750
AT2G03590 ATUPS1 ureide permease 1 (.1) Lus10037074 2.0 0.9652
AT4G14320 Zinc-binding ribosomal protein... Lus10017396 4.0 0.9545
AT5G27700 Ribosomal protein S21e (.1) Lus10015173 4.5 0.9641
AT3G52590 HAP4, ERD16, UB... HAPLESS 4, EARLY-RESPONSIVE TO... Lus10008873 6.0 0.9596
AT1G41880 Ribosomal protein L35Ae family... Lus10028254 8.1 0.9509
AT4G29410 Ribosomal L28e protein family ... Lus10032699 9.5 0.9537
AT4G14320 Zinc-binding ribosomal protein... Lus10010195 10.4 0.9507

Lus10020410 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.