Plant FIBer expression Database

Lus10020417 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G15820 55 / 2e-10 CP24, LHCB6 light harvesting complex photosystem II subunit 6 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015834
[exp]
80 / 9e-20 AT1G15820 393 / 7e-140 light harvesting complex photosystem II subunit 6 (.1)
Lus10015831
[exp]
66 / 2e-14 AT1G15820 384 / 2e-136 light harvesting complex photosystem II subunit 6 (.1)
Lus10020415
[exp]
66 / 3e-14 AT1G15820 379 / 9e-130 light harvesting complex photosystem II subunit 6 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G210000
[exp]
57 / 2e-11 AT1G15820 424 / 7e-152 light harvesting complex photosystem II subunit 6 (.1)
Potri.003G020400
[exp]
56 / 8e-11 AT1G15820 421 / 9e-151 light harvesting complex photosystem II subunit 6 (.1)
PFAM info
Representative CDS sequence
>Lus10020417 pacid=23139565 polypeptide=Lus10020417 locus=Lus10020417.g ID=Lus10020417.BGIv1.0 annot-version=v1.0
ATGGCGGCTGCTGCTACTTCAGGAGCTGTGTTGAACGTGACACTGAAATCGTCCTTCTTCAGTGGAAGCAAGAGCAGCCAATCATCACTTTTGGCTGCGC
CGGCTTCCAGACCGGCCGCCATTGGTGGTGGTAGAAGAAAATTGGTAATAGTAGCTGCTAAGAAATCATGGATCCCTGCTGTTAAAGGCGGCGGCAACCT
CGTCGATCCCGAATGGCTCGATGGCTCTTGTTTCGTCGTCTTCATTAATTAA
AA sequence
>Lus10020417 pacid=23139565 polypeptide=Lus10020417 locus=Lus10020417.g ID=Lus10020417.BGIv1.0 annot-version=v1.0
MAAAATSGAVLNVTLKSSFFSGSKSSQSSLLAAPASRPAAIGGGRRKLVIVAAKKSWIPAVKGGGNLVDPEWLDGSCFVVFIN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G15820 CP24, LHCB6 light harvesting complex photo... Lus10020417
[exp]
0 1
AT5G46110 TPT, APE2 triose-phosphate ⁄ phosp... Lus10013978
[exp]
2.0 0.9260
AT1G74470 Pyridine nucleotide-disulphide... Lus10001642
[exp]
5.1 0.9232
AT2G34430 LHCB1.4, LHB1B1 light-harvesting chlorophyll-p... Lus10038489
[exp]
5.9 0.9146
AT5G46110 TPT, APE2 triose-phosphate ⁄ phosp... Lus10015399
[exp]
8.5 0.9102
AT5G23120 HCF136 HIGH CHLOROPHYLL FLUORESCENCE ... Lus10017401
[exp]
8.5 0.9158
AT5G07020 proline-rich family protein (.... Lus10005388
[exp]
10.4 0.9192
AT3G12780 PGK1 phosphoglycerate kinase 1 (.1) Lus10031168
[exp]
10.5 0.9177
AT1G15820 CP24, LHCB6 light harvesting complex photo... Lus10015834
[exp]
10.8 0.9041
AT3G12780 PGK1 phosphoglycerate kinase 1 (.1) Lus10031744
[exp]
11.1 0.9182
AT1G74470 Pyridine nucleotide-disulphide... Lus10021665
[exp]
13.1 0.9100

Lus10020417 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.