Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G15820 245 / 7e-83 CP24, LHCB6 light harvesting complex photosystem II subunit 6 (.1) AT1G45474 69 / 1e-14 LHCA5 photosystem I light harvesting complex gene 5 (.1.2) AT1G61520 67 / 8e-14 LHCA3*1, LHCA3*1, LHCA3*1 photosystem I light harvesting complex gene 3 (.1.2.3) AT5G01530 65 / 7e-13 LHCB4.1 light harvesting complex photosystem II (.1) AT2G40100 64 / 2e-12 LHCB4.3 light harvesting complex photosystem II (.1.2) AT3G61470 62 / 4e-12 LHCA2 photosystem I light harvesting complex gene 2 (.1) AT3G08940 60 / 5e-11 LHCB4.2 light harvesting complex photosystem II (.1.2) AT1G19150 59 / 5e-11 LHCA2*1, LHCA2*1, LHCA2*1, LHCA2*1, LHCA2*1, LHCA2*1, LHCA2*1, LHCA6, LHCA2*1, LHCA2*1, LHCA2*1, LH photosystem I light harvesting complex gene 6 (.1) AT5G54270 52 / 3e-08 LHCB3*1, LHCB3*1, LHCB3*1, LHCB3*1, LHCB3*1, LHCB3*1, LHCB3*1, LHCB3*1, LHCB3*1, LHCB3*1, LHCB3*1, light-harvesting chlorophyll B-binding protein 3 (.1) AT3G47470 48 / 5e-07 CAB4, LHCA4 light-harvesting chlorophyll-protein complex I subunit A4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015834 [exp] 283 / 9e-98 AT1G15820 393 / 7e-140 light harvesting complex photosystem II subunit 6 (.1) Lus10015831 [exp] 281 / 2e-97 AT1G15820 384 / 2e-136 light harvesting complex photosystem II subunit 6 (.1) Lus10020415 [exp] 283 / 6e-94 AT1G15820 379 / 9e-130 light harvesting complex photosystem II subunit 6 (.1) Lus10042657 [exp] 76 / 6e-17 AT1G45474 371 / 3e-131 photosystem I light harvesting complex gene 5 (.1.2) Lus10021730 [exp] 74 / 3e-16 AT1G45474 369 / 2e-130 photosystem I light harvesting complex gene 5 (.1.2) Lus10012297 [exp] 71 / 5e-15 AT1G61520 474 / 2e-171 photosystem I light harvesting complex gene 3 (.1.2.3) Lus10016074 [exp] 71 / 5e-15 AT1G61520 474 / 2e-171 photosystem I light harvesting complex gene 3 (.1.2.3) Lus10011361 [exp] 62 / 8e-12 AT3G61470 414 / 6e-148 photosystem I light harvesting complex gene 2 (.1) Lus10006416 [exp] 62 / 9e-12 AT3G61470 404 / 6e-144 photosystem I light harvesting complex gene 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G020400 [exp] 266 / 2e-91 AT1G15820 421 / 9e-151 light harvesting complex photosystem II subunit 6 (.1) Potri.001G210000 [exp] 265 / 4e-91 AT1G15820 424 / 7e-152 light harvesting complex photosystem II subunit 6 (.1) Potri.014G029700 [exp] 67 / 9e-14 AT1G45474 306 / 3e-105 photosystem I light harvesting complex gene 5 (.1.2) Potri.014G172400 [exp] 64 / 9e-13 AT1G61520 362 / 3e-127 photosystem I light harvesting complex gene 3 (.1.2.3) Potri.008G067300 [exp] 64 / 2e-12 AT2G40100 420 / 7e-150 light harvesting complex photosystem II (.1.2) Potri.006G139600 [exp] 62 / 4e-12 AT1G19150 393 / 1e-139 photosystem I light harvesting complex gene 6 (.1) Potri.016G115200 [exp] 61 / 2e-11 AT3G08940 449 / 4e-161 light harvesting complex photosystem II (.1.2) Potri.003G171500 [exp] 59 / 9e-11 AT3G61470 409 / 5e-146 photosystem I light harvesting complex gene 2 (.1) Potri.001G056700 [exp] 59 / 9e-11 AT3G61470 410 / 3e-146 photosystem I light harvesting complex gene 2 (.1) Potri.006G099500 [exp] 58 / 2e-10 AT3G08940 474 / 7e-171 light harvesting complex photosystem II (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00504 [flax] [poplar] Chloroa_b-bind Chlorophyll A-B binding protein
Representative CDS sequence Show only first row Show all	>Lus10020418 pacid=23139552 polypeptide=Lus10020418 locus=Lus10020418.g ID=Lus10020418.BGIv1.0 annot-version=v1.0 ATGGTACAGAGAAGCGGAGCTCATCCACGGACGGTGGGCGATGGCGGCGGGGGTGGGGATATTTGTTGGGGAGGGATGGGGCAGGCATGGAGCGGAATCC CGTGGTTCGAGGCAGGAGCAGACCCGGGTGCTATTGCTCCGTTCTCGTTCGGGTCACTGCTGGGTACCCAACTCATACTCATGGGTTGGGTTGAGAGCAA GAGATGGGTTGATTTCTTCAACCCGGACTCCCAGTCGGTGGAATGGGCGACACCTTGGTCAAGGACTTCCGAGAATTTTGCGAATGCCACGGGGGAACAG GGTTACCCGGGTGGGAAGTTCTTCGACCCGCTTGGGTTCGCCGGAACATTGAAGGACGGAGAGTACATTGCCGACGGAGAGAAGCTTGAGAGATTGAAGT TGGCTGAGATCAAACACGCTAGGCTCGCCATGTTGGCGATGCTCATCTTTTACTTCGAAGCTGGACAGGGCAAAACCCCTCTCGGCGCTCTCGGCCTTTA G
AA sequence Show only first row Show all	>Lus10020418 pacid=23139552 polypeptide=Lus10020418 locus=Lus10020418.g ID=Lus10020418.BGIv1.0 annot-version=v1.0 MVQRSGAHPRTVGDGGGGGDICWGGMGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLILMGWVESKRWVDFFNPDSQSVEWATPWSRTSENFANATGEQ GYPGGKFFDPLGFAGTLKDGEYIADGEKLERLKLAEIKHARLAMLAMLIFYFEAGQGKTPLGALGL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G15820		CP24, LHCB6	light harvesting complex photo...		Lus10020418 [exp]	0	1
AT1G15820		CP24, LHCB6	light harvesting complex photo...		Lus10015831 [exp]	1.0	0.9622
AT1G15820		CP24, LHCB6	light harvesting complex photo...		Lus10020415 [exp]	1.4	0.9607
AT4G37200		HCF164	HIGH CHLOROPHYLL FLUORESCENCE ...		Lus10016780 [exp]	1.7	0.9522
AT1G15820		CP24, LHCB6	light harvesting complex photo...		Lus10015834 [exp]	2.4	0.9406
AT4G28660		PSB28	photosystem II reaction center...		Lus10022867 [exp]	3.5	0.9415
AT3G04790		EMB3119	EMBRYO DEFECTIVE 3119, Ribose ...		Lus10009181 [exp]	3.6	0.9195
AT1G09900			Pentatricopeptide repeat (PPR-...		Lus10037013 [exp]	4.2	0.9117
AT3G47470		CAB4, LHCA4	light-harvesting chlorophyll-p...		Lus10021663 [exp]	6.3	0.9412
AT1G61520		LHCA3*1, LHCA3*...	photosystem I light harvesting...		Lus10012297 [exp]	9.8	0.9366
AT1G29930		LHCB1.3, CAB140...	LIGHT-HARVESTING CHLOROPHYLL A...		Lus10042219 [exp]	9.8	0.9241

Compare expression of checked genes

Lus10020418 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.