Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022092 [exp] 149 / 7e-49 ND / Lus10029468 [exp] 140 / 7e-45 ND / Lus10007688 [exp] 137 / 4e-43 ND / Lus10024787 [exp] 135 / 1e-42 ND / Lus10032483 [exp] 134 / 2e-42 ND / Lus10006524 [exp] 132 / 2e-42 ND / Lus10032986 [exp] 132 / 3e-42 ND / Lus10029058 [exp] 137 / 6e-42 ND / Lus10005957 [exp] 138 / 1e-41 AT1G48120 75 / 1e-14 hydrolases;protein serine/threonine phosphatases (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020426 pacid=23139566 polypeptide=Lus10020426 locus=Lus10020426.g ID=Lus10020426.BGIv1.0 annot-version=v1.0 ATGTACTGTTATCGACGCCACACCCACCCGCACAACCTCAAGCCCCTTCCTACTGGTGTTCAGGCGCCGAAAGATTTGCTAGCTTACAGGGTGTTGGACT ATATGCATCCATACCTTGTTGGGACGATGAGACAGGAGTACGAGTCTGATGTTGAGTACCTGGAGGTGGTCGAGCATCTCAGATGCAGTGTTGCAGACAT GTACGTGGACTTTCGCCACCAGAGACCGTACCGTTAG
AA sequence Show only first row Show all	>Lus10020426 pacid=23139566 polypeptide=Lus10020426 locus=Lus10020426.g ID=Lus10020426.BGIv1.0 annot-version=v1.0 MYCYRRHTHPHNLKPLPTGVQAPKDLLAYRVLDYMHPYLVGTMRQEYESDVEYLEVVEHLRCSVADMYVDFRHQRPYR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10020426 [exp]	0	1
AT2G36190		ATCWINV4	cell wall invertase 4 (.1)		Lus10014217 [exp]	4.1	1.0000
AT4G35500			Protein kinase superfamily pro...		Lus10016690 [exp]	6.0	1.0000
AT5G14760		AO	L-aspartate oxidase (.1)		Lus10018901 [exp]	7.1	1.0000
AT5G24070			Peroxidase superfamily protein...		Lus10027049 [exp]	7.2	1.0000
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10027891 [exp]	8.1	1.0000
AT5G56790			Protein kinase superfamily pro...		Lus10000773 [exp]	12.8	1.0000
AT5G49900			Beta-glucosidase, GBA2 type fa...		Lus10023340 [exp]	14.1	1.0000
					Lus10023520 [exp]	14.2	1.0000
					Lus10008789 [exp]	15.6	1.0000
AT1G35720		ATOXY5, ANNAT1	annexin 1 (.1)		Lus10036470 [exp]	15.9	1.0000

Compare expression of checked genes

Lus10020426 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.