Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G29460 67 / 4e-15 SAUR-like auxin-responsive protein family (.1) AT1G29500 61 / 4e-13 SAUR-like auxin-responsive protein family (.1) AT1G29450 61 / 5e-13 SAUR-like auxin-responsive protein family (.1) AT1G29510 61 / 5e-13 SAUR68 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) AT1G29430 60 / 1e-12 SAUR-like auxin-responsive protein family (.1) AT1G29420 59 / 2e-12 SAUR-like auxin-responsive protein family (.1) AT5G27780 57 / 1e-11 SAUR-like auxin-responsive protein family (.1) AT1G29440 57 / 1e-11 SAUR-like auxin-responsive protein family (.1) AT1G29490 55 / 6e-11 SAUR-like auxin-responsive protein family (.1) AT1G76190 55 / 6e-11 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007057 [exp] 175 / 2e-58 AT1G29450 72 / 2e-17 SAUR-like auxin-responsive protein family (.1) Lus10007059 [exp] 106 / 2e-31 AT1G29430 66 / 6e-15 SAUR-like auxin-responsive protein family (.1) Lus10020431 [exp] 102 / 4e-30 AT1G29430 69 / 2e-16 SAUR-like auxin-responsive protein family (.1) Lus10020439 [exp] 84 / 4e-22 AT1G29510 67 / 5e-15 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Lus10007068 [exp] 83 / 7e-22 AT1G29510 68 / 1e-15 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Lus10007060 [exp] 80 / 3e-20 AT1G29430 71 / 2e-16 SAUR-like auxin-responsive protein family (.1) Lus10007069 [exp] 79 / 4e-20 AT1G29430 69 / 3e-16 SAUR-like auxin-responsive protein family (.1) Lus10020440 [exp] 78 / 8e-20 AT1G29430 72 / 3e-17 SAUR-like auxin-responsive protein family (.1) Lus10007067 [exp] 76 / 2e-19 AT1G29430 69 / 4e-16 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G141251 [exp] 69 / 5e-16 AT1G29430 93 / 7e-25 SAUR-like auxin-responsive protein family (.1) Potri.017G043400 [exp] 62 / 3e-13 AT5G27780 141 / 8e-44 SAUR-like auxin-responsive protein family (.1) Potri.009G141100 [exp] 59 / 2e-12 AT1G29510 117 / 8e-35 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Potri.009G141201 [exp] 58 / 5e-12 AT5G27780 132 / 3e-40 SAUR-like auxin-responsive protein family (.1) Potri.005G196850 [exp] 58 / 2e-11 AT1G29510 102 / 2e-27 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Potri.004G181400 [exp] 57 / 2e-11 AT1G29450 132 / 4e-40 SAUR-like auxin-responsive protein family (.1) Potri.009G141150 [exp] 56 / 4e-11 AT1G29450 131 / 5e-40 SAUR-like auxin-responsive protein family (.1) Potri.017G043500 [exp] 54 / 2e-10 AT5G27780 120 / 1e-35 SAUR-like auxin-responsive protein family (.1) Potri.009G140900 [exp] 53 / 8e-10 AT1G29510 139 / 3e-43 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Potri.009G141000 [exp] 51 / 3e-09 AT1G29500 122 / 2e-36 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10020430 pacid=23139604 polypeptide=Lus10020430 locus=Lus10020430.g ID=Lus10020430.BGIv1.0 annot-version=v1.0 ATGGCTGTCCATGGAAAGCTTACAAGAGTGGTGAAGAAATTGATGGGGAAGAAGAAGGGTTGGTTCGTGGTCTACTCGATGAACAGACGGAGGTACGCTT TGCCGTTGGAGTTGTTGGAGAAACAAATATTCGTGGAGATGCTGAAGATGACTGAGGATGAGTTCGGCCTTTCGAATCACCAACCTATTGTGTTTCCGTT CCATTCTGCTGTGATGGATCCTGTTATTGAGTTCTTGCTCAGTCATCAGCAAGGAGCGTACCAAGACCAAGTCGTGATGATGATGCCGATTGGGTATTCT TCTTGA
AA sequence Show only first row Show all	>Lus10020430 pacid=23139604 polypeptide=Lus10020430 locus=Lus10020430.g ID=Lus10020430.BGIv1.0 annot-version=v1.0 MAVHGKLTRVVKKLMGKKKGWFVVYSMNRRRYALPLELLEKQIFVEMLKMTEDEFGLSNHQPIVFPFHSAVMDPVIEFLLSHQQGAYQDQVVMMMPIGYS S

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G29460			SAUR-like auxin-responsive pro...		Lus10020430 [exp]	0	1
					Lus10033534 [exp]	4.6	0.9872
AT3G29090		PME31, ATPME31	A. THALIANA PECTIN METHYLESTER...		Lus10024050 [exp]	4.7	0.9762
AT4G25300			2-oxoglutarate (2OG) and Fe(II...		Lus10003652 [exp]	6.0	0.8385
AT2G36620		RPL24A	ribosomal protein L24 (.1)		Lus10014637 [exp]	6.5	0.9872
					Lus10039990 [exp]	7.9	0.9872
AT3G61150	HD	HD-GL2-1, HDG1	HOMEODOMAIN-GLABRA2 1, homeodo...		Lus10038876 [exp]	9.2	0.9872
AT1G43780		SCPL44	serine carboxypeptidase-like 4...		Lus10040330 [exp]	10.2	0.9872
					Lus10022805 [exp]	11.2	0.9872
AT5G05530			RING/U-box superfamily protein...		Lus10024629 [exp]	12.1	0.9872
AT2G15220			Plant basic secretory protein ...		Lus10026579 [exp]	13.0	0.9872

Compare expression of checked genes

Lus10020430 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.