Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G29430 70 / 1e-16 SAUR-like auxin-responsive protein family (.1) AT1G29510 68 / 6e-16 SAUR68 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) AT1G29450 67 / 2e-15 SAUR-like auxin-responsive protein family (.1) AT1G29500 66 / 2e-15 SAUR-like auxin-responsive protein family (.1) AT5G27780 66 / 4e-15 SAUR-like auxin-responsive protein family (.1) AT1G29460 66 / 4e-15 SAUR-like auxin-responsive protein family (.1) AT1G29440 65 / 1e-14 SAUR-like auxin-responsive protein family (.1) AT1G29490 63 / 2e-14 SAUR-like auxin-responsive protein family (.1) AT1G29420 63 / 3e-14 SAUR-like auxin-responsive protein family (.1) AT1G20470 54 / 1e-10 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007059 [exp] 137 / 1e-43 AT1G29430 66 / 6e-15 SAUR-like auxin-responsive protein family (.1) Lus10007057 [exp] 124 / 2e-38 AT1G29450 72 / 2e-17 SAUR-like auxin-responsive protein family (.1) Lus10020430 [exp] 102 / 5e-30 AT1G29460 66 / 5e-15 SAUR-like auxin-responsive protein family (.1) Lus10007060 [exp] 75 / 1e-18 AT1G29430 71 / 2e-16 SAUR-like auxin-responsive protein family (.1) Lus10007068 [exp] 69 / 1e-16 AT1G29510 68 / 1e-15 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Lus10007067 [exp] 68 / 2e-16 AT1G29430 69 / 4e-16 SAUR-like auxin-responsive protein family (.1) Lus10020432 [exp] 68 / 3e-16 AT1G20470 69 / 3e-16 SAUR-like auxin-responsive protein family (.1) Lus10020439 [exp] 67 / 8e-16 AT1G29510 67 / 5e-15 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Lus10007069 [exp] 66 / 3e-15 AT1G29430 69 / 3e-16 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G141251 [exp] 68 / 5e-16 AT1G29430 93 / 7e-25 SAUR-like auxin-responsive protein family (.1) Potri.009G141201 [exp] 64 / 2e-14 AT5G27780 132 / 3e-40 SAUR-like auxin-responsive protein family (.1) Potri.004G181400 [exp] 64 / 3e-14 AT1G29450 132 / 4e-40 SAUR-like auxin-responsive protein family (.1) Potri.009G141150 [exp] 62 / 2e-13 AT1G29450 131 / 5e-40 SAUR-like auxin-responsive protein family (.1) Potri.009G141100 [exp] 61 / 3e-13 AT1G29510 117 / 8e-35 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Potri.017G043400 [exp] 59 / 1e-12 AT5G27780 141 / 8e-44 SAUR-like auxin-responsive protein family (.1) Potri.017G043500 [exp] 57 / 6e-12 AT5G27780 120 / 1e-35 SAUR-like auxin-responsive protein family (.1) Potri.009G140900 [exp] 53 / 3e-10 AT1G29510 139 / 3e-43 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Potri.009G141000 [exp] 50 / 6e-09 AT1G29500 122 / 2e-36 SAUR-like auxin-responsive protein family (.1) Potri.005G196850 [exp] 50 / 8e-09 AT1G29510 102 / 2e-27 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10020431 pacid=23139594 polypeptide=Lus10020431 locus=Lus10020431.g ID=Lus10020431.BGIv1.0 annot-version=v1.0 ATGAAGAAGTTGCAGCAAACTGCTGTTTTATCAGGGAAGAAGAAGGGGTGTTTCGTGGTATACACAGCAGACAAAAGAAGGTATGCGTTGCCATTGGAGT TGTTGGAGAAAGAAATGTTTGTAGAGATGTTGAAGTTGGCGGAGGAGGAATTCGGCCTCTCGAATCACCCATCTATCGTCTTCCCATTCGATTATCCGAT CATGGATCGTATTATCGACATCTTGCTCTCAAATAACCATCTACGTGGACGGCAGCAGAACTAG
AA sequence Show only first row Show all	>Lus10020431 pacid=23139594 polypeptide=Lus10020431 locus=Lus10020431.g ID=Lus10020431.BGIv1.0 annot-version=v1.0 MKKLQQTAVLSGKKKGCFVVYTADKRRYALPLELLEKEMFVEMLKLAEEEFGLSNHPSIVFPFDYPIMDRIIDILLSNNHLRGRQQN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G29430			SAUR-like auxin-responsive pro...		Lus10020431 [exp]	0	1
					Lus10000273 [exp]	2.6	1.0000
AT1G17930			Aminotransferase-like, plant m...		Lus10001981 [exp]	4.9	1.0000
AT1G04670			unknown protein		Lus10002298 [exp]	4.9	1.0000
AT4G13420		HAK5, ATHAK5	high affinity K+ transporter 5...		Lus10005194 [exp]	7.2	1.0000
					Lus10027667 [exp]	7.7	1.0000
					Lus10032828 [exp]	7.9	1.0000
AT3G04120		GAPC1, GAPC-1, ...	glyceraldehyde-3-phosphate deh...		Lus10033306 [exp]	8.4	1.0000
AT5G51030			NAD(P)-binding Rossmann-fold s...		Lus10032524 [exp]	8.5	1.0000
					Lus10015682 [exp]	8.5	1.0000
					Lus10019051 [exp]	8.8	1.0000

Compare expression of checked genes

Lus10020431 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.