Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G76190 66 / 6e-15 SAUR-like auxin-responsive protein family (.1) AT1G20470 66 / 1e-14 SAUR-like auxin-responsive protein family (.1) AT1G29460 64 / 1e-13 SAUR-like auxin-responsive protein family (.1) AT1G29420 62 / 2e-13 SAUR-like auxin-responsive protein family (.1) AT5G27780 62 / 2e-13 SAUR-like auxin-responsive protein family (.1) AT1G29430 62 / 3e-13 SAUR-like auxin-responsive protein family (.1) AT1G29510 62 / 5e-13 SAUR68 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) AT1G29450 61 / 1e-12 SAUR-like auxin-responsive protein family (.1) AT1G29490 59 / 2e-12 SAUR-like auxin-responsive protein family (.1) AT1G29440 60 / 3e-12 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007060 [exp] 183 / 9e-61 AT1G29430 71 / 2e-16 SAUR-like auxin-responsive protein family (.1) Lus10007067 [exp] 103 / 1e-29 AT1G29430 69 / 4e-16 SAUR-like auxin-responsive protein family (.1) Lus10007069 [exp] 102 / 4e-29 AT1G29430 69 / 3e-16 SAUR-like auxin-responsive protein family (.1) Lus10020441 [exp] 100 / 1e-28 AT1G29430 71 / 4e-17 SAUR-like auxin-responsive protein family (.1) Lus10020440 [exp] 99 / 1e-27 AT1G29430 72 / 3e-17 SAUR-like auxin-responsive protein family (.1) Lus10007068 [exp] 99 / 1e-27 AT1G29510 68 / 1e-15 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Lus10020439 [exp] 99 / 2e-27 AT1G29510 67 / 5e-15 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Lus10007066 [exp] 96 / 1e-26 AT1G29430 66 / 5e-15 SAUR-like auxin-responsive protein family (.1) Lus10007057 [exp] 77 / 3e-19 AT1G29450 72 / 2e-17 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G043400 [exp] 74 / 8e-18 AT5G27780 141 / 8e-44 SAUR-like auxin-responsive protein family (.1) Potri.002G064300 [exp] 74 / 1e-17 AT1G29510 109 / 2e-31 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Potri.004G181400 [exp] 73 / 2e-17 AT1G29450 132 / 4e-40 SAUR-like auxin-responsive protein family (.1) Potri.009G141251 [exp] 72 / 5e-17 AT1G29430 93 / 7e-25 SAUR-like auxin-responsive protein family (.1) Potri.005G196850 [exp] 72 / 1e-16 AT1G29510 102 / 2e-27 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Potri.009G141201 [exp] 70 / 2e-16 AT5G27780 132 / 3e-40 SAUR-like auxin-responsive protein family (.1) Potri.017G043500 [exp] 70 / 4e-16 AT5G27780 120 / 1e-35 SAUR-like auxin-responsive protein family (.1) Potri.009G140900 [exp] 69 / 1e-15 AT1G29510 139 / 3e-43 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Potri.009G141150 [exp] 65 / 2e-14 AT1G29450 131 / 5e-40 SAUR-like auxin-responsive protein family (.1) Potri.009G141100 [exp] 64 / 4e-14 AT1G29510 117 / 8e-35 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10020432 pacid=23139611 polypeptide=Lus10020432 locus=Lus10020432.g ID=Lus10020432.BGIv1.0 annot-version=v1.0 ATGGTTGTCCCAAGATCTCTGGTAAAGTTAACTATGCAGAAATGGATGAAGCAGCTTGGTGTAATGAGGGGAATGCAAATGGCTTCTTCTTCCTCTTCTT CTTCTTCTTGTAAGAGTAGTAAGGGTGGTCATTTTGTGGTTTACACAGTGGATAGAAGGAGGTTTTTGATACCATTGAAGTTTCTGAGAAGAATGGTGAT TGTGGAATTACTGAAGATGGCAGAAGATGAGTTTGGATTCTCAAGTGACGAGCCAATTGTGTTGCCATTTGAAGGTTATGTGATGGATCAAATCATGATG CTTCTATCCTCAGAATCAGATGCCCATTGTAGCATGCTAAGTACTCCACAATTCCTAATTAATTAG
AA sequence Show only first row Show all	>Lus10020432 pacid=23139611 polypeptide=Lus10020432 locus=Lus10020432.g ID=Lus10020432.BGIv1.0 annot-version=v1.0 MVVPRSLVKLTMQKWMKQLGVMRGMQMASSSSSSSSCKSSKGGHFVVYTVDRRRFLIPLKFLRRMVIVELLKMAEDEFGFSSDEPIVLPFEGYVMDQIMM LLSSESDAHCSMLSTPQFLIN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G20470			SAUR-like auxin-responsive pro...		Lus10020432 [exp]	0	1
AT1G66950		ABCG39, PDR11, ...	ATP-binding cassette G39, plei...		Lus10006277 [exp]	4.6	0.9055
AT2G29670			Tetratricopeptide repeat (TPR)...		Lus10025981 [exp]	6.5	0.9055
AT5G51740			Peptidase family M48 family pr...		Lus10032437 [exp]	7.9	0.9055
AT4G33920			Protein phosphatase 2C family ...		Lus10000700 [exp]	9.2	0.9055
AT4G20060		EMB1895	EMBRYO DEFECTIVE 1895, ARM rep...		Lus10038371 [exp]	10.2	0.9055
AT2G37360		ABCG2	ATP-binding cassette G2, ABC-2...		Lus10039859 [exp]	11.2	0.9055
AT5G58850	MYB	ATMYB119	myb domain protein 119 (.1)		Lus10040684 [exp]	12.1	0.9055
AT1G69940		ATPPME1	Pectin lyase-like superfamily ...		Lus10016711 [exp]	13.0	0.9055
AT1G35670		CPK11, ATCDPK2,...	calcium-dependent protein kina...		Lus10017911 [exp]	13.7	0.9055
AT1G01450			Protein kinase superfamily pro...		Lus10041113 [exp]	14.5	0.9055

Compare expression of checked genes

Lus10020432 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.