Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G29430 71 / 5e-17 SAUR-like auxin-responsive protein family (.1) AT1G29510 68 / 1e-15 SAUR68 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) AT1G29490 66 / 4e-15 SAUR-like auxin-responsive protein family (.1) AT5G27780 66 / 7e-15 SAUR-like auxin-responsive protein family (.1) AT1G29420 64 / 2e-14 SAUR-like auxin-responsive protein family (.1) AT1G76190 64 / 3e-14 SAUR-like auxin-responsive protein family (.1) AT1G29440 63 / 6e-14 SAUR-like auxin-responsive protein family (.1) AT1G29500 62 / 1e-13 SAUR-like auxin-responsive protein family (.1) AT1G29460 62 / 2e-13 SAUR-like auxin-responsive protein family (.1) AT1G20470 61 / 5e-13 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007069 [exp] 187 / 4e-63 AT1G29430 69 / 3e-16 SAUR-like auxin-responsive protein family (.1) Lus10007068 [exp] 180 / 2e-60 AT1G29510 68 / 1e-15 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Lus10007067 [exp] 175 / 3e-58 AT1G29430 69 / 4e-16 SAUR-like auxin-responsive protein family (.1) Lus10020440 [exp] 172 / 3e-57 AT1G29430 72 / 3e-17 SAUR-like auxin-responsive protein family (.1) Lus10007060 [exp] 112 / 6e-33 AT1G29430 71 / 2e-16 SAUR-like auxin-responsive protein family (.1) Lus10020439 [exp] 102 / 1e-29 AT1G29510 67 / 5e-15 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Lus10020432 [exp] 100 / 7e-29 AT1G20470 69 / 3e-16 SAUR-like auxin-responsive protein family (.1) Lus10007066 [exp] 96 / 8e-27 AT1G29430 66 / 5e-15 SAUR-like auxin-responsive protein family (.1) Lus10020430 [exp] 74 / 2e-18 AT1G29460 66 / 5e-15 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G043400 [exp] 70 / 2e-16 AT5G27780 141 / 8e-44 SAUR-like auxin-responsive protein family (.1) Potri.009G141251 [exp] 69 / 2e-16 AT1G29430 93 / 7e-25 SAUR-like auxin-responsive protein family (.1) Potri.017G043500 [exp] 69 / 3e-16 AT5G27780 120 / 1e-35 SAUR-like auxin-responsive protein family (.1) Potri.002G064300 [exp] 69 / 6e-16 AT1G29510 109 / 2e-31 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Potri.004G181400 [exp] 68 / 8e-16 AT1G29450 132 / 4e-40 SAUR-like auxin-responsive protein family (.1) Potri.005G196850 [exp] 70 / 9e-16 AT1G29510 102 / 2e-27 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Potri.009G141201 [exp] 67 / 2e-15 AT5G27780 132 / 3e-40 SAUR-like auxin-responsive protein family (.1) Potri.009G141150 [exp] 66 / 9e-15 AT1G29450 131 / 5e-40 SAUR-like auxin-responsive protein family (.1) Potri.009G141100 [exp] 65 / 1e-14 AT1G29510 117 / 8e-35 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Potri.009G140900 [exp] 59 / 2e-12 AT1G29510 139 / 3e-43 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10020441 pacid=23139529 polypeptide=Lus10020441 locus=Lus10020441.g ID=Lus10020441.BGIv1.0 annot-version=v1.0 ATGGCTCTCTCGAAAGCTCCGTCGATGATTAGAAGAATGCGGTTTGCTTCTTCTTCGAATGTCGACATCAAGGGTGGTCATTTTGTGGTTTACAGTATGG ATAATGTTCGGTTTGTGATACCGTTGAAGTTTTTGAAGAGTAAAATCATTGTGGAATTACTGAAGATGGCAGAAGATGAGTTCGGATTCTCAAGCGAACA ACCAATCGTGTTGCCATTCGAATCAAGAATCATGAACCAGATTGTCATGCATCTCTCGAAGTCCCGCCCGCAAGCTAACACCAGCTTGAGCAACTACGCA GCACAATTTTAA
AA sequence Show only first row Show all	>Lus10020441 pacid=23139529 polypeptide=Lus10020441 locus=Lus10020441.g ID=Lus10020441.BGIv1.0 annot-version=v1.0 MALSKAPSMIRRMRFASSSNVDIKGGHFVVYSMDNVRFVIPLKFLKSKIIVELLKMAEDEFGFSSEQPIVLPFESRIMNQIVMHLSKSRPQANTSLSNYA AQF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G29430			SAUR-like auxin-responsive pro...		Lus10020441 [exp]	0	1
AT3G16180			Major facilitator superfamily ...		Lus10009506 [exp]	2.2	1.0000
					Lus10033149 [exp]	3.2	1.0000
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10023215 [exp]	4.9	1.0000
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Lus10027028 [exp]	5.0	1.0000
AT3G14040			Pectin lyase-like superfamily ...		Lus10023364 [exp]	5.7	1.0000
AT1G21880		LYM1	lysm domain GPI-anchored prote...		Lus10006200 [exp]	5.9	1.0000
AT1G70690		HWI1, PDLP5	PLASMODESMATA-LOCATED PROTEIN ...		Lus10019334 [exp]	6.3	1.0000
AT1G75660		AtXRN3, XRN3	5'-3' exoribonuclease 3 (.1)		Lus10005213 [exp]	6.7	0.9900
AT5G33340		CDR1	CONSTITUTIVE DISEASE RESISTANC...		Lus10003281 [exp]	6.9	1.0000
					Lus10012394 [exp]	8.8	0.9772

Compare expression of checked genes

Lus10020441 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.