Lus10020443 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039999 148 / 5e-46 ND /
Lus10011639 127 / 1e-37 ND /
Lus10001229 70 / 3e-16 ND /
Lus10042626 61 / 2e-11 AT1G03840 265 / 3e-85 Magpie, C2H2 and C2HC zinc fingers superfamily protein (.1.2)
Lus10022026 42 / 4e-05 ND /
Lus10012405 40 / 0.0002 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10020443 pacid=23139567 polypeptide=Lus10020443 locus=Lus10020443.g ID=Lus10020443.BGIv1.0 annot-version=v1.0
ATGGGCTGGCAGGCTGGAAATTCACGTCCAAGACATACCCCTCTTGTGACCAACGTTTTGACGATTCACCATCTGGACTCGCTTCTGCTACATAAATTCA
AGGCGTCGGTGAAACCGACATGCGCTTACTGGGACGATTGCAAGATCGGAAGGGTCGTCAAGGATTTGAGGCAGGAGGGCAGTGGGTTCACATTCCAATT
CAGGGCTCGGGAGACCGTAGGTGCGGAGCTAGAACCGAAGGAGCTATCATGGATCAATGTCGAAGACGATGTCGTAAGCCCTGCCGAAGAAAACCAACAA
ACGATACAACAACAGTGGACCGTGCGATCAGCAATTAAAAGTGCCCGTCCTCGACAGGGGATTGCAAACGGGTACAAGAGACGAAGTTGTACTGTTGGCC
TAGACTATGGGAGACCTTGA
AA sequence
>Lus10020443 pacid=23139567 polypeptide=Lus10020443 locus=Lus10020443.g ID=Lus10020443.BGIv1.0 annot-version=v1.0
MGWQAGNSRPRHTPLVTNVLTIHHLDSLLLHKFKASVKPTCAYWDDCKIGRVVKDLRQEGSGFTFQFRARETVGAELEPKELSWINVEDDVVSPAEENQQ
TIQQQWTVRSAIKSARPRQGIANGYKRRSCTVGLDYGRP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10020443 0 1
AT5G26330 Cupredoxin superfamily protein... Lus10006680 6.8 1.0000
AT5G64820 unknown protein Lus10025572 9.6 1.0000
AT4G36670 AtPMT6, AtPLT6 polyol/monosaccharide transpor... Lus10017474 11.7 1.0000
Lus10038707 13.6 1.0000
AT4G18360 Aldolase-type TIM barrel famil... Lus10038144 16.4 1.0000
AT2G20825 ULT ULT2 ULTRAPETALA 2, Developmental r... Lus10038586 16.8 1.0000
AT1G68570 Major facilitator superfamily ... Lus10038648 18.5 1.0000
Lus10039663 19.4 1.0000
Lus10006079 21.0 1.0000
AT5G42800 M318, TT3, DFR dihydroflavonol 4-reductase (.... Lus10006195 21.4 1.0000

Lus10020443 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.