Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020448 pacid=23139527 polypeptide=Lus10020448 locus=Lus10020448.g ID=Lus10020448.BGIv1.0 annot-version=v1.0 ATGCTAATGATCAGCGTGAAAAGTCAAGCTGGATGTCCAACAATCTCGATCCTACGACTGCAGATGAAGCTCGGCGTTGACTTCAATCGGACGGCTTTCT TTCGTTCAGAGGCAGCGACTGGAAATGTGGCCAAAACTAATCCGTTGAAGAAGGTCCATGCTGAGAAGAAGGTCCCTGTTGTGAAAAAGGCCCCCTGA
AA sequence Show only first row Show all	>Lus10020448 pacid=23139527 polypeptide=Lus10020448 locus=Lus10020448.g ID=Lus10020448.BGIv1.0 annot-version=v1.0 MLMISVKSQAGCPTISILRLQMKLGVDFNRTAFFRSEAATGNVAKTNPLKKVHAEKKVPVVKKAP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10020448 [exp]	0	1
AT4G10260			pfkB-like carbohydrate kinase ...		Lus10028089 [exp]	1.0	0.8971
AT5G04530		KCS19	3-ketoacyl-CoA synthase 19 (.1...		Lus10002191 [exp]	23.0	0.8797
					Lus10007097 [exp]	28.3	0.8721
AT1G75880		EXL1	SGNH hydrolase-type esterase s...		Lus10034541 [exp]	45.4	0.8669
					Lus10020978 [exp]	67.5	0.8378
					Lus10007554 [exp]	109.6	0.7823
AT3G57030			Calcium-dependent phosphotries...		Lus10019148 [exp]	133.5	0.7634
AT4G38580		HIPP26, ATFP6	HEAVY METAL ASSOCIATED ISOPREN...		Lus10014120 [exp]	151.8	0.8495
AT1G75880		EXL1	SGNH hydrolase-type esterase s...		Lus10003719 [exp]	192.8	0.8319
AT4G09960	MADS	AGL11, STK	SEEDSTICK, AGAMOUS-like 11, K-...		Lus10009481 [exp]	201.7	0.8346

Compare expression of checked genes

Lus10020448 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.