Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019563 [exp] 107 / 8e-29 ND / Lus10012405 [exp] 97 / 8e-26 ND / Lus10010393 [exp] 92 / 9e-24 ND / Lus10042626 [exp] 81 / 3e-19 AT1G03840 265 / 3e-85 Magpie, C2H2 and C2HC zinc fingers superfamily protein (.1.2) Lus10026801 [exp] 76 / 3e-17 AT5G24530 142 / 7e-38 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10016935 [exp] 64 / 3e-14 ND / Lus10022026 [exp] 59 / 1e-11 ND / Lus10033901 [exp] 56 / 3e-11 ND / Lus10032678 [exp] 55 / 4e-10 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020449 pacid=23139553 polypeptide=Lus10020449 locus=Lus10020449.g ID=Lus10020449.BGIv1.0 annot-version=v1.0 ATGAAGTTGTACATGTTGCTTGCCCTTGGTTCGATGCTTGTTGCCACAAATACCTGGTGTGTGACGATGAAGTTTTCCAAGTATCATCATCTTGGCAATG TCGAGATCGCCAGCCACAACTGGGTGGCCCACGTCTCAAATCATCTGCTACGAGGTATGGAGCACTACTACCGGAATTGTAAGGCTTCCTATCCCAGCGG GGACATGAACTTCATGGTTACCACTATTGGCCGATTGGTTATGCCTAATATCCCATGTTATTTATGCGAGCTCCAATTTGTAGACATGGTTGATCTTCCT GGTATTGGTTTGAACGAGCATCCCACTTGTTCGTACTAA
AA sequence Show only first row Show all	>Lus10020449 pacid=23139553 polypeptide=Lus10020449 locus=Lus10020449.g ID=Lus10020449.BGIv1.0 annot-version=v1.0 MKLYMLLALGSMLVATNTWCVTMKFSKYHHLGNVEIASHNWVAHVSNHLLRGMEHYYRNCKASYPSGDMNFMVTTIGRLVMPNIPCYLCELQFVDMVDLP GIGLNEHPTCSY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10020449 [exp]	0	1
					Lus10020450 [exp]	1.0	0.8807
AT2G38180			SGNH hydrolase-type esterase s...		Lus10027790 [exp]	7.3	0.6398
AT4G33280	B3	REM16	AP2/B3-like transcriptional fa...		Lus10025388 [exp]	9.4	0.6235
AT3G22845			emp24/gp25L/p24 family/GOLD fa...		Lus10006623 [exp]	12.6	0.6327
AT1G33590			Leucine-rich repeat (LRR) fami...		Lus10002937 [exp]	20.7	0.6327
AT3G21090		ABCG15	ATP-binding cassette G15, ABC-...		Lus10035445 [exp]	23.1	0.6422
AT1G69630			F-box/RNI-like superfamily pro...		Lus10029588 [exp]	28.8	0.6303
AT2G34930			disease resistance family prot...		Lus10016337 [exp]	42.1	0.5830
AT3G55700			UDP-Glycosyltransferase superf...		Lus10040244 [exp]	50.5	0.5676
AT1G78790			unknown protein		Lus10042781 [exp]	52.2	0.5837

Compare expression of checked genes

Lus10020449 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.