Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G13275 36 / 0.0002 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007090 [exp] 87 / 2e-24 AT3G13275 65 / 1e-15 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G107500 [exp] 50 / 7e-10 AT3G13275 62 / 6e-15 unknown protein Potri.005G061200 [exp] 49 / 2e-09 AT3G13275 63 / 6e-15 unknown protein Potri.001G469401 [exp] 47 / 1e-08 AT3G13275 / unknown protein Potri.011G166250 [exp] 45 / 7e-08 AT3G13275 38 / 4e-05 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020466 pacid=23139558 polypeptide=Lus10020466 locus=Lus10020466.g ID=Lus10020466.BGIv1.0 annot-version=v1.0 ATGTGCTGCGGGGGCAGAGTGTGCATGATGTGCACGTGCGTGATTCTGGTTGTAGTGTTGATCGGTTTGTTGTTCGGATTCGGAGTATTCAAGGATGGGT TCCACAAGTTGAAGGACACCGTTCACGATATCAATCACCTCCAGCAGCAGGTTGATGATTTCCACAGCCGTCCTTTCCTCAAAGGCTTCCATGCTCCGCC TCCCTTCTAA
AA sequence Show only first row Show all	>Lus10020466 pacid=23139558 polypeptide=Lus10020466 locus=Lus10020466.g ID=Lus10020466.BGIv1.0 annot-version=v1.0 MCCGGRVCMMCTCVILVVVLIGLLFGFGVFKDGFHKLKDTVHDINHLQQQVDDFHSRPFLKGFHAPPPF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G13275			unknown protein		Lus10020466 [exp]	0	1
AT4G39790			Protein of unknown function (D...		Lus10024039 [exp]	3.6	0.8978
AT1G75820		ATCLV1, FLO5, F...	FLOWER DEVELOPMENT 5, FASCIATA...		Lus10013562 [exp]	5.9	0.8525
AT4G37750	AP2_ERF	DRG, CKC1, ANT	DRAGON, COMPLEMENTING A PROTEI...		Lus10039650 [exp]	10.3	0.8793
AT2G19930			RNA-dependent RNA polymerase f...		Lus10012965 [exp]	14.4	0.8458
AT4G37750	AP2_ERF	DRG, CKC1, ANT	DRAGON, COMPLEMENTING A PROTEI...		Lus10011730 [exp]	19.9	0.8676
AT2G05760			Xanthine/uracil permease famil...		Lus10030014 [exp]	21.1	0.8682
AT5G58230		MSI1, MEE70, AT...	MATERNAL EFFECT EMBRYO ARREST ...		Lus10033459 [exp]	25.5	0.8564
AT3G06868			unknown protein		Lus10001474 [exp]	26.9	0.8237
AT3G07610		IBM1	increase in bonsai methylation...		Lus10002391 [exp]	28.2	0.8597
					Lus10024691 [exp]	30.2	0.7754

Compare expression of checked genes

Lus10020466 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.