Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G20510 94 / 4e-24 OPCL1 OPC-8:0 CoA ligase1 (.1.2) AT1G20490 94 / 4e-24 AMP-dependent synthetase and ligase family protein (.1) AT1G20500 92 / 2e-23 AMP-dependent synthetase and ligase family protein (.1) AT5G38120 84 / 1e-20 4CL8 AMP-dependent synthetase and ligase family protein (.1) AT1G20480 79 / 1e-18 AMP-dependent synthetase and ligase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015998 [exp] 137 / 1e-39 AT1G20510 833 / 0.0 OPC-8:0 CoA ligase1 (.1.2) Lus10015999 [exp] 82 / 9e-20 AT1G20510 692 / 0.0 OPC-8:0 CoA ligase1 (.1.2) Lus10007063 [exp] 55 / 2e-10 AT1G20510 119 / 9e-32 OPC-8:0 CoA ligase1 (.1.2) Lus10012280 [exp] 0 / 1 AT1G20510 825 / 0.0 OPC-8:0 CoA ligase1 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G248500 [exp] 102 / 6e-27 AT1G20510 795 / 0.0 OPC-8:0 CoA ligase1 (.1.2) Potri.002G012800 [exp] 87 / 2e-21 AT1G20510 769 / 0.0 OPC-8:0 CoA ligase1 (.1.2) Potri.003G099700 [exp] 39 / 0.0001 AT4G19010 634 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020473 pacid=23139606 polypeptide=Lus10020473 locus=Lus10020473.g ID=Lus10020473.BGIv1.0 annot-version=v1.0 ATGGAGCCGCCGATCAACTCAGTGATTGACCCGAGATCGGGATTCTCCCAATCCAACTTGGTTTTGTACAGCAAACGTAACCCAATCCCTCTCCCACCAA ACCCTTCCCTCGACGTCACAACCTTCATCTCTTCTCAAGCTCACCACGGCAAGACCGCCTTCATCGACGCCGCCACCGGCCGCCACCTCACTTTCCGAGA CCTATGTCCGCCGCCAATCCCTCGCCACGCACCTCTCGGGAACCATGGGAATCCGAAAGGGACACGTCGTCCTCCTCCTATCCCCTAA
AA sequence Show only first row Show all	>Lus10020473 pacid=23139606 polypeptide=Lus10020473 locus=Lus10020473.g ID=Lus10020473.BGIv1.0 annot-version=v1.0 MEPPINSVIDPRSGFSQSNLVLYSKRNPIPLPPNPSLDVTTFISSQAHHGKTAFIDAATGRHLTFRDLCPPPIPRHAPLGNHGNPKGTRRPPPIP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G20500			AMP-dependent synthetase and l...		Lus10020473 [exp]	0	1
AT5G59700			Protein kinase superfamily pro...		Lus10020474 [exp]	1.0	0.9527
AT1G74830			Protein of unknown function, D...		Lus10036656 [exp]	2.4	0.8855
AT1G09157			Protein of unknown function (D...		Lus10030466 [exp]	3.9	0.8430
AT1G03495			HXXXD-type acyl-transferase fa...		Lus10014077 [exp]	4.2	0.8587
					Lus10001257 [exp]	5.5	0.8351
AT3G11570		TBL8	TRICHOME BIREFRINGENCE-LIKE 8 ...		Lus10021328 [exp]	5.7	0.8128
AT3G11570		TBL8	TRICHOME BIREFRINGENCE-LIKE 8 ...		Lus10000250 [exp]	7.2	0.8477
AT1G01040		SIN1, EMB76, EM...	SHORT INTEGUMENTS 1, EMBRYO DE...		Lus10005141 [exp]	8.8	0.8012
					Lus10013473 [exp]	11.0	0.7769
AT3G17980		AtC2	Arabidopsis thaliana C2 domain...		Lus10009684 [exp]	12.0	0.7833

Compare expression of checked genes

Lus10020473 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.