Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G61350 91 / 5e-23 Protein kinase superfamily protein (.1) AT5G54380 87 / 9e-22 THE1 THESEUS1, protein kinase family protein (.1) AT1G30570 86 / 5e-21 HERK2 hercules receptor kinase 2 (.1) AT5G24010 84 / 2e-20 Protein kinase superfamily protein (.1) AT5G28680 83 / 4e-20 ANX2 ANXUR2, Malectin/receptor-like protein kinase family protein (.1) AT3G04690 82 / 1e-19 ANX1 ANXUR1, Malectin/receptor-like protein kinase family protein (.1) AT3G51550 82 / 1e-19 FER FERONIA, Malectin/receptor-like protein kinase family protein (.1) AT5G59700 82 / 1e-19 Protein kinase superfamily protein (.1) AT3G46290 81 / 1e-19 HERK1 hercules receptor kinase 1 (.1) AT2G21480 79 / 8e-19 Malectin/receptor-like protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010443 [exp] 119 / 1e-32 AT2G23200 498 / 6e-164 Protein kinase superfamily protein (.1) Lus10012101 [exp] 113 / 1e-30 AT2G23200 494 / 2e-162 Protein kinase superfamily protein (.1) Lus10000562 [exp] 87 / 1e-21 AT5G61350 965 / 0.0 Protein kinase superfamily protein (.1) Lus10021632 [exp] 87 / 1e-21 AT5G61350 971 / 0.0 Protein kinase superfamily protein (.1) Lus10037887 [exp] 87 / 1e-21 AT5G54380 1279 / 0.0 THESEUS1, protein kinase family protein (.1) Lus10038595 [exp] 86 / 2e-21 AT5G54380 718 / 0.0 THESEUS1, protein kinase family protein (.1) Lus10028140 [exp] 85 / 9e-21 AT3G46290 1024 / 0.0 hercules receptor kinase 1 (.1) Lus10042844 [exp] 85 / 1e-20 AT3G46290 1025 / 0.0 hercules receptor kinase 1 (.1) Lus10032976 [exp] 83 / 4e-20 AT3G51550 682 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G144200 [exp] 91 / 6e-23 AT5G24010 558 / 0.0 Protein kinase superfamily protein (.1) Potri.005G143700 [exp] 89 / 3e-22 AT5G24010 566 / 0.0 Protein kinase superfamily protein (.1) Potri.005G144100 [exp] 89 / 4e-22 AT5G24010 550 / 0.0 Protein kinase superfamily protein (.1) Potri.015G061700 [exp] 86 / 3e-21 AT5G61350 1020 / 0.0 Protein kinase superfamily protein (.1) Potri.009G120400 [exp] 86 / 5e-21 AT4G39110 1210 / 0.0 Malectin/receptor-like protein kinase family protein (.1) Potri.001G405500 [exp] 84 / 2e-20 AT5G54380 1232 / 0.0 THESEUS1, protein kinase family protein (.1) Potri.011G128000 [exp] 84 / 2e-20 AT5G54380 1231 / 0.0 THESEUS1, protein kinase family protein (.1) Potri.001G234200 [exp] 83 / 3e-20 AT3G46290 1106 / 0.0 hercules receptor kinase 1 (.1) Potri.009G026600 [exp] 83 / 4e-20 AT3G46290 1093 / 0.0 hercules receptor kinase 1 (.1) Potri.017G143049 [exp] 83 / 4e-20 AT5G24010 1071 / 0.0 Protein kinase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF00069 [flax] [poplar] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Lus10020474 pacid=23139609 polypeptide=Lus10020474 locus=Lus10020474.g ID=Lus10020474.BGIv1.0 annot-version=v1.0 ATGGATGTGAAGACCACAAACATATTGCAGGACGATAATTTGGTGGCGAATGTGACAAATTTCGGGCTATCACAGTCGGGTCCGCCTGATCCGGATCACC ATACCGTGGCGTTAAAAGGATGCTTCGGTTATCTCGATCCAAAATTCTTCAGGATGCTTCAGTTGACTGATAAATCCGACGTGTACACGTTGAGGAAATA TGTTGAGATTGCTGAGAAACGCTTGAGGGTGAATGGAGTGGAGAGGCCTGCGATGTAG
AA sequence Show only first row Show all	>Lus10020474 pacid=23139609 polypeptide=Lus10020474 locus=Lus10020474.g ID=Lus10020474.BGIv1.0 annot-version=v1.0 MDVKTTNILQDDNLVANVTNFGLSQSGPPDPDHHTVALKGCFGYLDPKFFRMLQLTDKSDVYTLRKYVEIAEKRLRVNGVERPAM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59700			Protein kinase superfamily pro...		Lus10020474 [exp]	0	1
AT1G20500			AMP-dependent synthetase and l...		Lus10020473 [exp]	1.0	0.9527
					Lus10001257 [exp]	2.4	0.8544
AT1G74830			Protein of unknown function, D...		Lus10036656 [exp]	3.2	0.8612
AT3G12660		FLA14	FASCICLIN-like arabinogalactan...		Lus10041630 [exp]	5.1	0.7816
AT1G03495			HXXXD-type acyl-transferase fa...		Lus10014077 [exp]	6.9	0.8382
AT3G11570		TBL8	TRICHOME BIREFRINGENCE-LIKE 8 ...		Lus10000250 [exp]	6.9	0.8504
AT3G62190			Chaperone DnaJ-domain superfam...		Lus10038040 [exp]	7.1	0.7450
AT3G11570		TBL8	TRICHOME BIREFRINGENCE-LIKE 8 ...		Lus10021328 [exp]	8.4	0.7848
AT2G21237			unknown protein		Lus10031077 [exp]	9.4	0.7842
AT5G39030			Protein kinase superfamily pro...		Lus10027116 [exp]	10.6	0.8227

Compare expression of checked genes

Lus10020474 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.