Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G37940 196 / 2e-64 MADS AGL21 AGAMOUS-like 21 (.1) AT3G57230 187 / 6e-61 MADS AGL16 AGAMOUS-like 16 (.1.2) AT2G22630 181 / 1e-58 MADS AGL17 AGAMOUS-like 17 (.1) AT2G14210 174 / 7e-56 MADS AGL44, ANR1 ARABIDOPSIS NITRATE REGULATED 1, AGAMOUS-like 44 (.1) AT2G45650 138 / 2e-41 MADS AGL6 AGAMOUS-like 6 (.1) AT4G09960 137 / 3e-41 MADS AGL11, STK SEEDSTICK, AGAMOUS-like 11, K-box region and MADS-box transcription factor family protein (.1.2.3.4) AT1G26310 133 / 2e-39 MADS CAL1, AGL10, CAL CAULIFLOWER, AGAMOUS-like 10, K-box region and MADS-box transcription factor family protein (.1) AT2G42830 131 / 1e-38 MADS AGL5, SHP2 SHATTERPROOF 2, AGAMOUS-like 5, K-box region and MADS-box transcription factor family protein (.1.2) AT4G18960 131 / 1e-38 MADS AG AGAMOUS, K-box region and MADS-box transcription factor family protein (.1.2) AT3G61120 130 / 2e-38 MADS AGL13 AGAMOUS-like 13 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007100 [exp] 260 / 5e-90 AT3G57230 226 / 4e-75 AGAMOUS-like 16 (.1.2) Lus10004638 [exp] 137 / 4e-41 AT3G02310 246 / 2e-82 SEPALLATA 2, AGAMOUS-like 4, K-box region and MADS-box transcription factor family protein (.1) Lus10026678 [exp] 135 / 1e-40 AT5G15800 225 / 3e-74 SEPALLATA1, AGAMOUS-like 2, K-box region and MADS-box transcription factor family protein (.1.2) Lus10008264 [exp] 136 / 2e-40 AT4G09960 328 / 3e-114 SEEDSTICK, AGAMOUS-like 11, K-box region and MADS-box transcription factor family protein (.1.2.3.4) Lus10005302 [exp] 135 / 4e-40 AT4G09960 330 / 2e-115 SEEDSTICK, AGAMOUS-like 11, K-box region and MADS-box transcription factor family protein (.1.2.3.4) Lus10009481 [exp] 132 / 2e-38 AT4G09960 274 / 1e-92 SEEDSTICK, AGAMOUS-like 11, K-box region and MADS-box transcription factor family protein (.1.2.3.4) Lus10003125 [exp] 126 / 1e-37 AT1G24260 290 / 9e-101 SEPALLATA3, AGAMOUS-like 9, K-box region and MADS-box transcription factor family protein (.1.2.3) Lus10005080 [exp] 127 / 4e-37 AT3G02310 372 / 1e-131 SEPALLATA 2, AGAMOUS-like 4, K-box region and MADS-box transcription factor family protein (.1) Lus10021140 [exp] 127 / 5e-37 AT5G60910 291 / 1e-99 FRUITFULL, AGAMOUS-like 8 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G079000 [exp] 211 / 5e-70 AT4G37940 293 / 3e-101 AGAMOUS-like 21 (.1) Potri.002G109601 [exp] 204 / 9e-68 AT3G57230 299 / 1e-103 AGAMOUS-like 16 (.1.2) Potri.001G284600 [exp] 203 / 4e-67 AT4G37940 272 / 7e-93 AGAMOUS-like 21 (.1) Potri.001G284301 [exp] 203 / 4e-67 AT4G37940 272 / 7e-93 AGAMOUS-like 21 (.1) Potri.005G150501 [exp] 199 / 5e-65 AT3G57230 322 / 8e-112 AGAMOUS-like 16 (.1.2) Potri.013G104900 [exp] 134 / 5e-40 AT4G09960 330 / 3e-116 SEEDSTICK, AGAMOUS-like 11, K-box region and MADS-box transcription factor family protein (.1.2.3.4) Potri.011G075800 [exp] 133 / 2e-39 AT4G18960 325 / 2e-113 AGAMOUS, K-box region and MADS-box transcription factor family protein (.1.2) Potri.004G064300 [exp] 132 / 2e-39 AT4G18960 313 / 8e-109 AGAMOUS, K-box region and MADS-box transcription factor family protein (.1.2) Potri.014G074100 [exp] 132 / 5e-39 AT2G45650 311 / 5e-108 AGAMOUS-like 6 (.1) Potri.001G058400 [exp] 128 / 1e-37 AT1G24260 362 / 8e-128 SEPALLATA3, AGAMOUS-like 9, K-box region and MADS-box transcription factor family protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01486 [flax] [poplar] K-box K-box region PF00319 [flax] [poplar] SRF-TF SRF-type transcription factor (DNA-binding and dimerisation domain)
Representative CDS sequence Show only first row Show all	>Lus10020477 pacid=23139543 polypeptide=Lus10020477 locus=Lus10020477.g ID=Lus10020477.BGIv1.0 annot-version=v1.0 ATGGGAAGGGGGAAGATAGTGATAAGGAGGATCGATGACAGAACGAGCAGGCAAGTGACCTTCTCAAAGAGAAGAACCGGTTTGATTAAGAAAGCAAAGG AGCTATCCATCCTTTGTGATGCTCAAGTTGCTCTCATTGTTTTCTCCACTACCAACAAGCTCTATGAATTTTCCAGCACCAGTATGATGTCAGTCATTGA TCGTTACACCAGACAGAAAGAAGCTCACATTCAACCATGCAATCCTGCATTAGAGATCAAGTTTTGGCAAAAGGAGGCAGCAAAGCTCGGGAAGGAATTG CAGTCCTTACATGAATATCACAGACAATTAATGGGAGAAGAACTATCATGCTTGGGTGTCAGAGATCTGCAAAATCTGGAAACCCAACTTGAGATTAGTT TGAAAGCTATTCGCCTCAACAAGGTACGTATATAA
AA sequence Show only first row Show all	>Lus10020477 pacid=23139543 polypeptide=Lus10020477 locus=Lus10020477.g ID=Lus10020477.BGIv1.0 annot-version=v1.0 MGRGKIVIRRIDDRTSRQVTFSKRRTGLIKKAKELSILCDAQVALIVFSTTNKLYEFSSTSMMSVIDRYTRQKEAHIQPCNPALEIKFWQKEAAKLGKEL QSLHEYHRQLMGEELSCLGVRDLQNLETQLEISLKAIRLNKVRI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G37940	MADS	AGL21	AGAMOUS-like 21 (.1)		Lus10020477 [exp]	0	1
					Lus10010826 [exp]	4.9	0.9413
					Lus10022108 [exp]	6.9	0.9413
AT2G36780			UDP-Glycosyltransferase superf...		Lus10023893 [exp]	8.5	0.9413
AT3G47090			Leucine-rich repeat protein ki...		Lus10028479 [exp]	9.8	0.9413
					Lus10030783 [exp]	11.0	0.9413
					Lus10003272 [exp]	12.0	0.9413
					Lus10036152 [exp]	13.0	0.9413
					Lus10037861 [exp]	13.9	0.9413
AT1G24430			HXXXD-type acyl-transferase fa...		Lus10037952 [exp]	14.7	0.9413
AT1G11040			HSP40/DnaJ peptide-binding pro...		Lus10025682 [exp]	15.5	0.9413

Compare expression of checked genes

Lus10020477 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.