Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF09598 [flax] [poplar] Stm1_N Stm1
Representative CDS sequence Show only first row Show all	>Lus10020479 pacid=23139591 polypeptide=Lus10020479 locus=Lus10020479.g ID=Lus10020479.BGIv1.0 annot-version=v1.0 ATGACCACCATAAACCCTTTCGATCTCCTCGACGATGTCGACAACGAGGATACCGATGCGCTCCTCGCCGTCGCTCAGCTGAAGATTGAGAAGAAAAAAG AAAAGCCAAAGGGTGCCACCACTGTTCCTCCTCCTCTCAACAAGCTGGCCCAGCAGAAGGCCGATAGGAAAAAAACCAATTGGTGA
AA sequence Show only first row Show all	>Lus10020479 pacid=23139591 polypeptide=Lus10020479 locus=Lus10020479.g ID=Lus10020479.BGIv1.0 annot-version=v1.0 MTTINPFDLLDDVDNEDTDALLAVAQLKIEKKKEKPKGATTVPPPLNKLAQQKADRKKTNW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10020479 [exp]	0	1
AT5G25610		ATRD22, RD22	RESPONSIVE TO DESSICATION 22, ...		Lus10024706 [exp]	4.5	0.7523
AT5G17680			disease resistance protein (TI...		Lus10012852 [exp]	6.0	0.7092
AT5G09360		LAC14	laccase 14 (.1)		Lus10026812 [exp]	10.0	0.7406
AT1G64870			unknown protein		Lus10002022 [exp]	16.4	0.6671
AT1G01490			Heavy metal transport/detoxifi...		Lus10024672 [exp]	17.9	0.6710
AT1G30720			FAD-binding Berberine family p...		Lus10009639 [exp]	19.1	0.7053
AT5G38460			ALG6, ALG8 glycosyltransferase...		Lus10033554 [exp]	20.3	0.6058
AT3G09290	C2H2ZnF	TAC1	telomerase activator1 (.1)		Lus10021213 [exp]	23.5	0.6981
					Lus10038003 [exp]	24.0	0.6653
AT5G60900		RLK1	receptor-like protein kinase 1...		Lus10031231 [exp]	28.0	0.6766

Compare expression of checked genes

Lus10020479 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.