Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G14610 169 / 4e-54 PR-1, PR1, ATPR1 pathogenesis-related gene 1 (.1) AT4G33720 169 / 5e-54 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT2G14580 167 / 3e-53 ATPRB1 basic pathogenesis-related protein 1 (.1) AT3G19690 154 / 3e-48 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT1G50060 146 / 3e-45 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G33730 145 / 2e-44 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT2G19990 145 / 2e-44 PR-1-LIKE pathogenesis-related protein-1-like (.1) AT5G26130 141 / 5e-43 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25790 139 / 2e-41 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT1G01310 139 / 2e-41 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020480 [exp] 275 / 2e-95 AT2G14610 182 / 3e-59 pathogenesis-related gene 1 (.1) Lus10007102 [exp] 182 / 6e-59 AT2G14610 182 / 3e-59 pathogenesis-related gene 1 (.1) Lus10020491 [exp] 176 / 9e-57 AT2G14610 207 / 2e-69 pathogenesis-related gene 1 (.1) Lus10020493 [exp] 161 / 6e-51 AT2G14610 206 / 9e-69 pathogenesis-related gene 1 (.1) Lus10012479 [exp] 161 / 8e-51 AT2G14610 208 / 7e-70 pathogenesis-related gene 1 (.1) Lus10025697 [exp] 157 / 6e-49 AT1G50060 213 / 1e-71 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10012478 [exp] 153 / 1e-47 AT2G14610 170 / 1e-54 pathogenesis-related gene 1 (.1) Lus10006980 [exp] 137 / 5e-41 AT4G30320 203 / 1e-67 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10015522 [exp] 135 / 2e-40 AT4G30320 199 / 7e-66 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G288600 [exp] 184 / 1e-59 AT2G14610 214 / 6e-72 pathogenesis-related gene 1 (.1) Potri.009G083300 [exp] 179 / 4e-58 AT2G14610 203 / 9e-68 pathogenesis-related gene 1 (.1) Potri.009G083100 [exp] 179 / 8e-58 AT2G14610 201 / 4e-67 pathogenesis-related gene 1 (.1) Potri.009G083000 [exp] 179 / 8e-58 AT4G33720 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.001G288301 [exp] 174 / 7e-56 AT2G14580 202 / 1e-67 basic pathogenesis-related protein 1 (.1) Potri.009G082900 [exp] 165 / 5e-52 AT2G14610 179 / 5e-58 pathogenesis-related gene 1 (.1) Potri.001G288401 [exp] 160 / 1e-50 AT2G14610 178 / 4e-58 pathogenesis-related gene 1 (.1) Potri.009G082800 [exp] 158 / 8e-50 AT2G14610 171 / 4e-55 pathogenesis-related gene 1 (.1) Potri.009G083600 [exp] 155 / 2e-48 AT1G50060 205 / 1e-68 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.018G096007 [exp] 130 / 7e-39 AT4G30320 215 / 1e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0659 [flax] [poplar] CAP PF00188 [flax] [poplar] CAP Cysteine-rich secretory protein family
Representative CDS sequence Show only first row Show all	>Lus10020481 pacid=23139584 polypeptide=Lus10020481 locus=Lus10020481.g ID=Lus10020481.BGIv1.0 annot-version=v1.0 ATGACGGTACCGTTAACCTTCCTAAACCTTACACTAATACTACTCATAATATCTTCATCATCACTCCTCCATTTCACGACCGCCCAGAACTCCCCGCGAG ATTTCGTCGACGCCCACAACCGAGCCCGAGCCGCGGTGGGAGTGGGGCCCATCAGGTGGGACCAAAGGGTGGCTGCTTACGCCCGTAACTACGGCAACAA AATCAAAGCCAACTGCAAGTTCGAGCACTCCGGTGGGCCCTACGGAGAGAATCTAGCGTTCGCTAAGCCCGACCTCACGGGGAGGAAATCGGTGCAGATG TGGGTGGGCGAGAAGAAATTCTACGACTGCAGAGGCAACAGGTGCACCGGCGGAGGAGAATGCCGCCACTTTACACAGGTGGTTTGGAAGGACTCCACCA AGCTGGGCTGCGCTAGGGTCGTGTGCAACCGGAACAAGGGTACTATTGTCATTTGCAGTTACGATCCTCCGGGCAACTTCCAAGGCCGCCGACCGTACAC TTGTCGCCGTAACTCTCTCGCTGAACATTTCGACGAGTATATTGATCAGTATGTGTAG
AA sequence Show only first row Show all	>Lus10020481 pacid=23139584 polypeptide=Lus10020481 locus=Lus10020481.g ID=Lus10020481.BGIv1.0 annot-version=v1.0 MTVPLTFLNLTLILLIISSSSLLHFTTAQNSPRDFVDAHNRARAAVGVGPIRWDQRVAAYARNYGNKIKANCKFEHSGGPYGENLAFAKPDLTGRKSVQM WVGEKKFYDCRGNRCTGGGECRHFTQVVWKDSTKLGCARVVCNRNKGTIVICSYDPPGNFQGRRPYTCRRNSLAEHFDEYIDQYV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10020481 [exp]	0	1
AT1G29050		TBL38	TRICHOME BIREFRINGENCE-LIKE 38...		Lus10039559 [exp]	3.0	0.9379
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10010573 [exp]	8.1	0.9086
					Lus10018643 [exp]	8.4	0.9278
AT2G43590			Chitinase family protein (.1)		Lus10035624 [exp]	9.2	0.9125
AT4G02830			unknown protein		Lus10042573 [exp]	10.2	0.9242
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10020480 [exp]	13.4	0.9133
AT1G51340			MATE efflux family protein (.1...		Lus10042365 [exp]	13.5	0.9073
AT3G57330		ACA11	autoinhibited Ca2+-ATPase 11, ...		Lus10042040 [exp]	16.7	0.9142
AT2G14830			Regulator of Vps4 activity in ...		Lus10033703 [exp]	17.0	0.9174
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10039349 [exp]	18.3	0.8994

Compare expression of checked genes

Lus10020481 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.