Lus10020482 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G14610 125 / 2e-37 PR-1, PR1, ATPR1 pathogenesis-related gene 1 (.1)
AT4G33720 117 / 2e-34 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
AT2G14580 115 / 2e-33 ATPRB1 basic pathogenesis-related protein 1 (.1)
AT3G19690 105 / 2e-29 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
AT5G26130 97 / 5e-26 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
AT2G19990 96 / 8e-26 PR-1-LIKE pathogenesis-related protein-1-like (.1)
AT4G25790 96 / 2e-25 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
AT1G50060 94 / 4e-25 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
AT4G07820 94 / 7e-25 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
AT4G33730 94 / 7e-25 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007102 243 / 2e-83 AT2G14610 182 / 3e-59 pathogenesis-related gene 1 (.1)
Lus10020493 127 / 8e-38 AT2G14610 206 / 9e-69 pathogenesis-related gene 1 (.1)
Lus10012479 127 / 8e-38 AT2G14610 208 / 7e-70 pathogenesis-related gene 1 (.1)
Lus10020481 121 / 2e-35 AT2G14610 176 / 6e-57 pathogenesis-related gene 1 (.1)
Lus10020491 120 / 3e-35 AT2G14610 207 / 2e-69 pathogenesis-related gene 1 (.1)
Lus10020480 114 / 8e-33 AT2G14610 182 / 3e-59 pathogenesis-related gene 1 (.1)
Lus10025697 110 / 4e-31 AT1G50060 213 / 1e-71 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Lus10012478 105 / 2e-29 AT2G14610 170 / 1e-54 pathogenesis-related gene 1 (.1)
Lus10020492 88 / 8e-23 AT2G14610 157 / 4e-50 pathogenesis-related gene 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G288600 125 / 3e-37 AT2G14610 214 / 6e-72 pathogenesis-related gene 1 (.1)
Potri.009G083000 124 / 8e-37 AT4G33720 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Potri.009G083300 123 / 1e-36 AT2G14610 203 / 9e-68 pathogenesis-related gene 1 (.1)
Potri.009G082800 122 / 5e-36 AT2G14610 171 / 4e-55 pathogenesis-related gene 1 (.1)
Potri.009G083100 121 / 6e-36 AT2G14610 201 / 4e-67 pathogenesis-related gene 1 (.1)
Potri.001G288301 119 / 7e-35 AT2G14580 202 / 1e-67 basic pathogenesis-related protein 1 (.1)
Potri.009G083600 117 / 5e-34 AT1G50060 205 / 1e-68 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Potri.001G288401 113 / 1e-32 AT2G14610 178 / 4e-58 pathogenesis-related gene 1 (.1)
Potri.009G082900 110 / 3e-31 AT2G14610 179 / 5e-58 pathogenesis-related gene 1 (.1)
Potri.006G171300 91 / 6e-24 AT4G30320 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10020482 pacid=23139614 polypeptide=Lus10020482 locus=Lus10020482.g ID=Lus10020482.BGIv1.0 annot-version=v1.0
ATGTCGATTCTCAACCTTCCTCCTCTCATTACTCTCCTGATCTTCAAGCTTTTAGTCTCGGTTCATCCCACCCTAGCCCAAAACAGCCCCGCGGACTACC
TCAGGGCCCATAACCAAGCCCGTGCCCAAGTCGGAGTCGGGCCCATGATATGGGATGCCAACGTGGCCGCCTACGCTCAGCGTTGTGCCAACAGTAGGAG
GGACTGCCAGCTCATTCATTCATCCGGCCCCTACGGCGAGAATCTCGCCATGGGAAGGCCGGATCTCACAGCGGTAGCGGCCGTGAAAATGTTGGGTTGT
GCTAGAGTGAAATGCAACAACGGAAGGGGCACCTTCGTGATCTGCAGTTATGCTCCTAGGGGCAACATTGTCGGGCGACGCCCTTACCCTAGGTGTTTCT
CGTCGAACGAGGATGTTATTGCCGGTGTTACAAGTTATTAA
AA sequence
>Lus10020482 pacid=23139614 polypeptide=Lus10020482 locus=Lus10020482.g ID=Lus10020482.BGIv1.0 annot-version=v1.0
MSILNLPPLITLLIFKLLVSVHPTLAQNSPADYLRAHNQARAQVGVGPMIWDANVAAYAQRCANSRRDCQLIHSSGPYGENLAMGRPDLTAVAAVKMLGC
ARVKCNNGRGTFVICSYAPRGNIVGRRPYPRCFSSNEDVIAGVTSY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G14610 PR-1, PR1, ATPR... pathogenesis-related gene 1 (.... Lus10020482 0 1

Lus10020482 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.