Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G65032 95 / 3e-27 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007103 [exp] 150 / 4e-49 AT1G65032 117 / 3e-36 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G094100 [exp] 122 / 6e-38 AT1G65032 107 / 6e-32 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020483 pacid=23139616 polypeptide=Lus10020483 locus=Lus10020483.g ID=Lus10020483.BGIv1.0 annot-version=v1.0 ATGGCGAAAGGATTGGTGTGGGCGACAGCTGAAGATTTGGCACGGAATAGAGGGTGTGTTCTGTCTCTGTACCGCCAACTATTACGCAGTCTCAACTCTC CAAGTTTACCCCTTAATTTAGCAGCAAGATTGGCTAAGAAGGCTGAAGTTCGTGCCATCTTCTTGCTGGGATCCGAGGAGAAGTCTGTCCACAATATCAA GGATCTCACTGACACTGCTGAATACGCTTTGGGTCTCCTCAGAAAGGGTGAGATTCCCAAGTATATACAATGA
AA sequence Show only first row Show all	>Lus10020483 pacid=23139616 polypeptide=Lus10020483 locus=Lus10020483.g ID=Lus10020483.BGIv1.0 annot-version=v1.0 MAKGLVWATAEDLARNRGCVLSLYRQLLRSLNSPSLPLNLAARLAKKAEVRAIFLLGSEEKSVHNIKDLTDTAEYALGLLRKGEIPKYIQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G65032			unknown protein		Lus10020483 [exp]	0	1
AT3G09890			Ankyrin repeat family protein ...		Lus10023911 [exp]	2.8	0.7778
AT4G08460			Protein of unknown function (D...		Lus10024758 [exp]	5.7	0.7980
AT1G64750		DSS1(I), ATDSS1...	deletion of SUV3 suppressor 1(...		Lus10030583 [exp]	5.7	0.8169
AT3G06610			DNA-binding enhancer protein-r...		Lus10037773 [exp]	8.6	0.8164
AT2G29540		ATRPAC14, ATRPC...	RNApolymerase 14 kDa subunit (...		Lus10040717 [exp]	10.8	0.8059
AT1G26750			unknown protein		Lus10016383 [exp]	16.7	0.7710
AT3G18510			unknown protein		Lus10032475 [exp]	16.8	0.7922
AT4G38370			Phosphoglycerate mutase family...		Lus10023935 [exp]	17.3	0.7457
AT5G20180			Ribosomal protein L36 (.1.2)		Lus10019412 [exp]	17.3	0.7602
AT2G43780			unknown protein		Lus10035718 [exp]	19.4	0.7623

Compare expression of checked genes

Lus10020483 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.