Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G14610 207 / 2e-69 PR-1, PR1, ATPR1 pathogenesis-related gene 1 (.1) AT2G14580 192 / 1e-63 ATPRB1 basic pathogenesis-related protein 1 (.1) AT4G33720 191 / 4e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT3G19690 177 / 8e-58 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G26130 177 / 1e-57 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT2G19990 162 / 2e-51 PR-1-LIKE pathogenesis-related protein-1-like (.1) AT4G33730 160 / 6e-51 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G33710 158 / 4e-50 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT1G50060 155 / 4e-49 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT3G09590 152 / 1e-47 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012479 [exp] 228 / 2e-77 AT2G14610 208 / 7e-70 pathogenesis-related gene 1 (.1) Lus10020493 [exp] 227 / 3e-77 AT2G14610 206 / 9e-69 pathogenesis-related gene 1 (.1) Lus10020492 [exp] 214 / 2e-72 AT2G14610 157 / 4e-50 pathogenesis-related gene 1 (.1) Lus10020480 [exp] 181 / 2e-58 AT2G14610 182 / 3e-59 pathogenesis-related gene 1 (.1) Lus10007102 [exp] 179 / 3e-58 AT2G14610 182 / 3e-59 pathogenesis-related gene 1 (.1) Lus10020481 [exp] 177 / 4e-57 AT2G14610 176 / 6e-57 pathogenesis-related gene 1 (.1) Lus10025697 [exp] 168 / 1e-53 AT1G50060 213 / 1e-71 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10015522 [exp] 152 / 4e-47 AT4G30320 199 / 7e-66 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10006980 [exp] 148 / 5e-46 AT4G30320 203 / 1e-67 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G083300 [exp] 211 / 4e-71 AT2G14610 203 / 9e-68 pathogenesis-related gene 1 (.1) Potri.009G083000 [exp] 210 / 1e-70 AT4G33720 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G083100 [exp] 210 / 2e-70 AT2G14610 201 / 4e-67 pathogenesis-related gene 1 (.1) Potri.009G082900 [exp] 192 / 3e-63 AT2G14610 179 / 5e-58 pathogenesis-related gene 1 (.1) Potri.001G288301 [exp] 189 / 3e-62 AT2G14580 202 / 1e-67 basic pathogenesis-related protein 1 (.1) Potri.001G288401 [exp] 182 / 1e-59 AT2G14610 178 / 4e-58 pathogenesis-related gene 1 (.1) Potri.001G288600 [exp] 181 / 6e-59 AT2G14610 214 / 6e-72 pathogenesis-related gene 1 (.1) Potri.009G083600 [exp] 176 / 5e-57 AT1G50060 205 / 1e-68 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.018G096007 [exp] 157 / 1e-49 AT4G30320 215 / 1e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G082800 [exp] 153 / 4e-48 AT2G14610 171 / 4e-55 pathogenesis-related gene 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0659 [flax] [poplar] CAP PF00188 [flax] [poplar] CAP Cysteine-rich secretory protein family
Representative CDS sequence Show only first row Show all	>Lus10020491 pacid=23139586 polypeptide=Lus10020491 locus=Lus10020491.g ID=Lus10020491.BGIv1.0 annot-version=v1.0 ATGGCACCCTCAGTACTCCTTTTCATTGCAATCGCATTACTTGGAACACTAGCATTCCCTGCATCCGCACAAGACTCTCCACAAGACTACCTCGACTCCC ACAACCAGGCCCGCTCCATGGTTGGAGTGGCCCCCGTATCATGGGATGAAAGACTGGCATCCTATGCACGTAACTATGCCGGCCAACGGGCTGCAGCAGA CTGTCGCCTCATCCACTCTGGTGGTCCCTACGGGGAGAACCTAGCCTGGGGCAGTGGACAGATGTCCGGGAAGTATTCCGTGGCGATGTGGGTGAATGAA AAGGCATATTACGACTACAACTCCAACACGTGCGCCCAAGGCGAGGTTTGCGGCCATTACACACAGGTTGTGTGGCGGAGGAGCACTAGCATTGGATGTG CCAAGGCTACTTGCAGCGGCGGCCGGGGTACTTTCGTCATTTGCAGCTACTCTCCTCGTGGTAATTACATTGGCGAGAGACCTTACTAG
AA sequence Show only first row Show all	>Lus10020491 pacid=23139586 polypeptide=Lus10020491 locus=Lus10020491.g ID=Lus10020491.BGIv1.0 annot-version=v1.0 MAPSVLLFIAIALLGTLAFPASAQDSPQDYLDSHNQARSMVGVAPVSWDERLASYARNYAGQRAAADCRLIHSGGPYGENLAWGSGQMSGKYSVAMWVNE KAYYDYNSNTCAQGEVCGHYTQVVWRRSTSIGCAKATCSGGRGTFVICSYSPRGNYIGERPY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10020491 [exp]	0	1
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10020492 [exp]	1.0	0.9719
AT1G34670	MYB	ATMYB93	myb domain protein 93 (.1)		Lus10039771 [exp]	2.0	0.8964
AT1G01490			Heavy metal transport/detoxifi...		Lus10027522 [exp]	4.2	0.8938
AT1G10340			Ankyrin repeat family protein ...		Lus10038609 [exp]	5.0	0.8710
AT5G48380		BIR1	BAK1-interacting receptor-like...		Lus10037226 [exp]	6.0	0.8654
					Lus10023082 [exp]	8.7	0.8164
AT3G51550		FER	FERONIA, Malectin/receptor-lik...		Lus10029946 [exp]	8.9	0.8628
AT5G48380		BIR1	BAK1-interacting receptor-like...		Lus10036697 [exp]	10.4	0.8794
					Lus10041663 [exp]	12.7	0.8469
					Lus10012064 [exp]	15.5	0.8335

Compare expression of checked genes

Lus10020491 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.