Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33720 134 / 3e-41 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT2G14610 133 / 1e-40 PR-1, PR1, ATPR1 pathogenesis-related gene 1 (.1) AT2G14580 126 / 6e-38 ATPRB1 basic pathogenesis-related protein 1 (.1) AT1G50060 123 / 1e-36 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G26130 121 / 5e-36 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT3G19690 109 / 2e-31 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT2G19990 109 / 3e-31 PR-1-LIKE pathogenesis-related protein-1-like (.1) AT4G07820 104 / 2e-29 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G33730 101 / 7e-28 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT3G09590 100 / 3e-27 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020491 [exp] 190 / 4e-63 AT2G14610 207 / 2e-69 pathogenesis-related gene 1 (.1) Lus10012479 [exp] 156 / 1e-49 AT2G14610 208 / 7e-70 pathogenesis-related gene 1 (.1) Lus10020493 [exp] 154 / 5e-49 AT2G14610 206 / 9e-69 pathogenesis-related gene 1 (.1) Lus10025697 [exp] 127 / 2e-38 AT1G50060 213 / 1e-71 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10007102 [exp] 115 / 3e-33 AT2G14610 182 / 3e-59 pathogenesis-related gene 1 (.1) Lus10020481 [exp] 109 / 5e-31 AT2G14610 176 / 6e-57 pathogenesis-related gene 1 (.1) Lus10020480 [exp] 106 / 7e-30 AT2G14610 182 / 3e-59 pathogenesis-related gene 1 (.1) Lus10012478 [exp] 105 / 2e-29 AT2G14610 170 / 1e-54 pathogenesis-related gene 1 (.1) Lus10001319 [exp] 97 / 4e-26 AT4G30320 201 / 6e-67 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G083100 [exp] 147 / 2e-46 AT2G14610 201 / 4e-67 pathogenesis-related gene 1 (.1) Potri.009G083300 [exp] 147 / 2e-46 AT2G14610 203 / 9e-68 pathogenesis-related gene 1 (.1) Potri.009G083000 [exp] 144 / 3e-45 AT4G33720 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G082900 [exp] 134 / 2e-40 AT2G14610 179 / 5e-58 pathogenesis-related gene 1 (.1) Potri.001G288301 [exp] 121 / 6e-36 AT2G14580 202 / 1e-67 basic pathogenesis-related protein 1 (.1) Potri.009G083600 [exp] 120 / 1e-35 AT1G50060 205 / 1e-68 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.001G288600 [exp] 117 / 3e-34 AT2G14610 214 / 6e-72 pathogenesis-related gene 1 (.1) Potri.001G288401 [exp] 115 / 2e-33 AT2G14610 178 / 4e-58 pathogenesis-related gene 1 (.1) Potri.009G082800 [exp] 112 / 3e-32 AT2G14610 171 / 4e-55 pathogenesis-related gene 1 (.1) Potri.018G096007 [exp] 101 / 3e-28 AT4G30320 215 / 1e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0659 [flax] [poplar] CAP PF00188 [flax] [poplar] CAP Cysteine-rich secretory protein family
Representative CDS sequence Show only first row Show all	>Lus10020492 pacid=23139572 polypeptide=Lus10020492 locus=Lus10020492.g ID=Lus10020492.BGIv1.0 annot-version=v1.0 ATGGCACCGTCAGTACCCATTTTCATTGCAATGATATATTTTGCAACACTAGCATTCCCTTCATCGGCACAAGACTCACCACAAGACTACCTCGACTCCC ACAACAATGCCCGCTCCATGGTTGGAGTGGGCCCCGTAACATGGGATGACACGCTGGCGTCCTACGCACAATCCTACGCCAACCAAAGGGCTGCAGGAGA CTGCAGCCTGGTCCACTCTGGTGGTCCCTACGGGGAGAACCTAGCTGGCGGGAGCGGCGGAGAGTTGTCCGGGGCGAGGTCGGTGGCGATGTGGGTGAGT GAGAAGGTAGATTACGACTACAGCAGCAACACGTGCGCCCAAGGCAAGGTTTGCGGCCATTACACACAGGTTGTCTGGCGGAGGAGCACCAGTATTGGAT GA
AA sequence Show only first row Show all	>Lus10020492 pacid=23139572 polypeptide=Lus10020492 locus=Lus10020492.g ID=Lus10020492.BGIv1.0 annot-version=v1.0 MAPSVPIFIAMIYFATLAFPSSAQDSPQDYLDSHNNARSMVGVGPVTWDDTLASYAQSYANQRAAGDCSLVHSGGPYGENLAGGSGGELSGARSVAMWVS EKVDYDYSSNTCAQGKVCGHYTQVVWRRSTSIG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10020492 [exp]	0	1
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10020491 [exp]	1.0	0.9719
AT1G34670	MYB	ATMYB93	myb domain protein 93 (.1)		Lus10039771 [exp]	5.9	0.8593
AT5G48380		BIR1	BAK1-interacting receptor-like...		Lus10036697 [exp]	6.0	0.9044
AT1G10340			Ankyrin repeat family protein ...		Lus10038609 [exp]	6.9	0.8580
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10025410 [exp]	7.3	0.8911
AT5G48380		BIR1	BAK1-interacting receptor-like...		Lus10037226 [exp]	8.0	0.8500
AT3G51550		FER	FERONIA, Malectin/receptor-lik...		Lus10029946 [exp]	9.5	0.8502
AT3G54420		ATCHITIV, CHIV,...	CHITINASE CLASS IV, homolog of...		Lus10010864 [exp]	10.0	0.8609
AT5G52390			PAR1 protein (.1)		Lus10012788 [exp]	11.7	0.7812
AT5G26340		ATSTP13, MSS1, ...	SUGAR TRANSPORT PROTEIN 13, Ma...		Lus10021924 [exp]	12.7	0.8449

Compare expression of checked genes

Lus10020492 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.