Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G14610 152 / 7e-48 PR-1, PR1, ATPR1 pathogenesis-related gene 1 (.1) AT2G14580 143 / 4e-44 ATPRB1 basic pathogenesis-related protein 1 (.1) AT4G33720 142 / 8e-44 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT3G19690 130 / 4e-39 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G26130 130 / 6e-39 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G33730 125 / 4e-37 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G33710 121 / 2e-35 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT2G19990 114 / 2e-32 PR-1-LIKE pathogenesis-related protein-1-like (.1) AT5G57625 112 / 3e-31 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25790 108 / 4e-30 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012479 [exp] 231 / 8e-79 AT2G14610 208 / 7e-70 pathogenesis-related gene 1 (.1) Lus10020491 [exp] 179 / 2e-58 AT2G14610 207 / 2e-69 pathogenesis-related gene 1 (.1) Lus10020492 [exp] 145 / 2e-45 AT2G14610 157 / 4e-50 pathogenesis-related gene 1 (.1) Lus10007102 [exp] 140 / 8e-43 AT2G14610 182 / 3e-59 pathogenesis-related gene 1 (.1) Lus10020480 [exp] 128 / 6e-38 AT2G14610 182 / 3e-59 pathogenesis-related gene 1 (.1) Lus10020481 [exp] 126 / 5e-37 AT2G14610 176 / 6e-57 pathogenesis-related gene 1 (.1) Lus10012478 [exp] 119 / 2e-34 AT2G14610 170 / 1e-54 pathogenesis-related gene 1 (.1) Lus10025697 [exp] 118 / 6e-34 AT1G50060 213 / 1e-71 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10006980 [exp] 105 / 4e-29 AT4G30320 203 / 1e-67 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G083300 [exp] 168 / 6e-54 AT2G14610 203 / 9e-68 pathogenesis-related gene 1 (.1) Potri.009G083100 [exp] 167 / 1e-53 AT2G14610 201 / 4e-67 pathogenesis-related gene 1 (.1) Potri.009G083000 [exp] 160 / 6e-51 AT4G33720 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G082900 [exp] 150 / 1e-46 AT2G14610 179 / 5e-58 pathogenesis-related gene 1 (.1) Potri.001G288600 [exp] 144 / 2e-44 AT2G14610 214 / 6e-72 pathogenesis-related gene 1 (.1) Potri.001G288301 [exp] 142 / 8e-44 AT2G14580 202 / 1e-67 basic pathogenesis-related protein 1 (.1) Potri.001G288401 [exp] 141 / 2e-43 AT2G14610 178 / 4e-58 pathogenesis-related gene 1 (.1) Potri.009G083600 [exp] 122 / 8e-36 AT1G50060 205 / 1e-68 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G082800 [exp] 117 / 9e-34 AT2G14610 171 / 4e-55 pathogenesis-related gene 1 (.1) Potri.018G007000 [exp] 109 / 1e-30 AT4G31470 185 / 6e-60 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0659 [flax] [poplar] CAP PF00188 [flax] [poplar] CAP Cysteine-rich secretory protein family
Representative CDS sequence Show only first row Show all	>Lus10020493 pacid=23139582 polypeptide=Lus10020493 locus=Lus10020493.g ID=Lus10020493.BGIv1.0 annot-version=v1.0 ATGTCGACTGTATACATTTCCTCCATTTTCCTTCTGATTACCCTAACATCATTGGCAACACTAACCCTCCCTTCATGCGCACAAGACTCCCCACAAGACT ACGTCAACGCCCACAACGCAGCCCGCTCCGCTGTCGGGGTGGGCCCCGTAACGTGGGACGCTGCCGTGGCGGCCTACGCGCAGTCCTACGCAAGGCAGCG TGCGGCAGGGGATTGCAAGCTGGTCCACTCCGGTGGGCCCTACGGTGAGAACCTAGCCTGGAGCAGCGGCCAGATGTCGGCTAAAGGTGCAGTTGGGATG TGGGTCAACGAGAAGGCGGATTATAACTACAACGCCAACACCTGCGCTCCGGGCAAAGTTTGCGGCCACTACACTCAGGTTGTGTGGAGGAGCACCGCCC GTATTGGGTGTGCCAAGGCGGCATGCAGCGGTGGAAAGGGCACTTTCATCATTTGTAACTACACTCCTCGTGGCAATATCGTCGGCCGTAAACCGTACTA A
AA sequence Show only first row Show all	>Lus10020493 pacid=23139582 polypeptide=Lus10020493 locus=Lus10020493.g ID=Lus10020493.BGIv1.0 annot-version=v1.0 MSTVYISSIFLLITLTSLATLTLPSCAQDSPQDYVNAHNAARSAVGVGPVTWDAAVAAYAQSYARQRAAGDCKLVHSGGPYGENLAWSSGQMSAKGAVGM WVNEKADYNYNANTCAPGKVCGHYTQVVWRSTARIGCAKAACSGGKGTFIICNYTPRGNIVGRKPY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10020493 [exp]	0	1
AT1G34210		ATSERK2, SERK2	somatic embryogenesis receptor...		Lus10004958 [exp]	2.0	0.9547
AT2G41480			Peroxidase superfamily protein...		Lus10012684 [exp]	2.6	0.9456
AT5G10530			Concanavalin A-like lectin pro...		Lus10033781 [exp]	4.1	0.9561
AT1G20030			Pathogenesis-related thaumatin...		Lus10004410 [exp]	4.9	0.9450
AT3G23230	AP2_ERF	ERF98	Integrase-type DNA-binding sup...		Lus10021196 [exp]	8.9	0.9335
AT1G60680		AGD2	NAD(P)-linked oxidoreductase s...		Lus10004399 [exp]	9.9	0.9555
AT1G14185			Glucose-methanol-choline (GMC)...		Lus10032641 [exp]	12.0	0.9487
AT4G29700			Alkaline-phosphatase-like fami...		Lus10000041 [exp]	12.7	0.9426
AT5G39150			RmlC-like cupins superfamily p...		Lus10033767 [exp]	15.6	0.9409
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10017014 [exp]	15.9	0.9105

Compare expression of checked genes

Lus10020493 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.