Lus10020494 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G14520 458 / 6e-161 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
AT4G33700 449 / 2e-157 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
AT1G47330 322 / 4e-106 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
AT5G52790 312 / 1e-102 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
AT4G14240 285 / 3e-92 CBS domain-containing protein with a domain of unknown function (DUF21) (.1), CBS domain-containing protein with a domain of unknown function (DUF21) (.2)
AT1G03270 281 / 9e-91 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
AT4G14230 277 / 5e-89 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
AT1G55930 53 / 2e-07 CBS domain-containing protein / transporter associated domain-containing protein (.1)
AT3G13070 53 / 3e-07 CBS domain-containing protein / transporter associated domain-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012476 605 / 0 AT2G14520 591 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
Lus10005259 482 / 2e-170 AT2G14520 679 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
Lus10030665 430 / 7e-152 AT2G14520 498 / 3e-178 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
Lus10032715 332 / 4e-110 AT1G47330 646 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
Lus10027528 324 / 4e-107 AT5G52790 560 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
Lus10039289 322 / 1e-106 AT5G52790 557 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
Lus10034024 296 / 3e-96 AT4G14230 675 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
Lus10012375 293 / 3e-95 AT1G03270 627 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
Lus10028010 291 / 1e-94 AT1G03270 635 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G288000 476 / 5e-168 AT2G14520 620 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
Potri.009G082300 466 / 8e-164 AT2G14520 593 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
Potri.014G012400 372 / 3e-127 AT2G14520 516 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
Potri.017G147900 337 / 3e-112 AT5G52790 580 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
Potri.014G196900 317 / 7e-104 AT1G47330 575 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
Potri.008G202100 290 / 3e-94 AT4G14240 632 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1), CBS domain-containing protein with a domain of unknown function (DUF21) (.2)
Potri.010G030200 290 / 7e-94 AT4G14240 611 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1), CBS domain-containing protein with a domain of unknown function (DUF21) (.2)
Potri.002G260401 53 / 4e-09 AT1G47330 58 / 3e-11 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
Potri.001G362100 51 / 1e-06 AT1G55930 858 / 0.0 CBS domain-containing protein / transporter associated domain-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01595 DUF21 Cyclin M transmembrane N-terminal domain
Representative CDS sequence
>Lus10020494 pacid=23139542 polypeptide=Lus10020494 locus=Lus10020494.g ID=Lus10020494.BGIv1.0 annot-version=v1.0
ATGGCGGTGGAGTACAGGTGCTGCGACACTGAATTCTTCCTTCAGATTGCGATAATTGTGCTGCTGGTGTTGTTCGCCGGTCTTATGTCCGGCCTAACTT
TGGGGCTAATGTCGATGAGCCTCGTCGATCTCGAAGTCGTGGCTAAATCTGGAAAACCTAAGGACCGCAAATACGCTGAAAGGATACTGCCAGTTGTTAG
AAATCAGCACCTAATGCTCTGCACACTCCTCATTTGCAATGCTGCTGCGATGGAGGCTCTCCCAATTTTCCTGGATAAACTGGTTACAGCACTGGGTGCC
GTTCTTATTTCAGTCACTCTGCTTCTTCTGTTTGGCGAGATTCTGCCACAAGCTTTTTGCTCTAGATATGGGCTAGCAATTGGTGCTACGGTAGCTCCAT
TCGTTCGCGTCCTTGTTTGGATATGCTTTCCTGTTGCCTATCCAATAAGCAAGGTTCTAGATTATGTCCTGGGTCATGAACATGTTGCTCTTTTTCGAAG
AGCTGAACTGAAAACACTAGTAAATATGCATGGGAACGAGGCTGGAAAAGGTGGAGAGCTCACCCATGATGAGACAACAATTATTGCTGGAGCACTAGAG
CTCACAGAGAAAACAGCAAGCGATGCAATGACTCCAATCTCCGATACATTCGCTATTGATATCAACGCTAAGCTTGACCGTGACATGATGAACTTGATAC
TAGAGAAAGGACACAGTCGAGTCCCAGTATATTATGAGCAACCTACAAACATCATTGGACTCATCCTGTACAACAAAGCAGAACAGCAACAGCAACAGTT
GATGCCTGCCGTCAGTAGTTCAACTGAAGGAGTTCCGGTTAAAGAAGTGAGGGTTGATGTGGACGGGAAGGCAAGTCAAGAGAAGTCATATAGAAGTAGG
AGCGCATCATTTCATAAATGGAAGAGCTTTGCCAACAGCAGCAACAGGTCATTGAAGAGTTCACAGAGCAGGAAAAGGGTGAAGGACAAAGTTGACTCCG
ACATCCTCAAAATGGACGGATACATCCCAACTCTTCCAGAGGAAGAAGAAGCCGTCGGACTCATAACAATGGAAGATCTCATCGAAGAACTTTTACAGGA
GGAGATTTACGATGAAACGGACCACCACTACGAAGAGTAG
AA sequence
>Lus10020494 pacid=23139542 polypeptide=Lus10020494 locus=Lus10020494.g ID=Lus10020494.BGIv1.0 annot-version=v1.0
MAVEYRCCDTEFFLQIAIIVLLVLFAGLMSGLTLGLMSMSLVDLEVVAKSGKPKDRKYAERILPVVRNQHLMLCTLLICNAAAMEALPIFLDKLVTALGA
VLISVTLLLLFGEILPQAFCSRYGLAIGATVAPFVRVLVWICFPVAYPISKVLDYVLGHEHVALFRRAELKTLVNMHGNEAGKGGELTHDETTIIAGALE
LTEKTASDAMTPISDTFAIDINAKLDRDMMNLILEKGHSRVPVYYEQPTNIIGLILYNKAEQQQQQLMPAVSSSTEGVPVKEVRVDVDGKASQEKSYRSR
SASFHKWKSFANSSNRSLKSSQSRKRVKDKVDSDILKMDGYIPTLPEEEEAVGLITMEDLIEELLQEEIYDETDHHYEE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G14520 CBS domain-containing protein ... Lus10020494 0 1
AT3G07140 GPI transamidase component Gpi... Lus10038183 7.7 0.6986
AT5G19450 CPK8, CDPK19 calcium-dependent protein kina... Lus10009947 9.0 0.7600
AT4G32180 ATPANK2 pantothenate kinase 2 (.1.2.3) Lus10009520 9.4 0.7401
AT1G78560 Sodium Bile acid symporter fam... Lus10035803 11.2 0.6911
AT5G04850 VPS60.2 SNF7 family protein (.1.2) Lus10043454 13.4 0.6712
AT4G16650 O-fucosyltransferase family pr... Lus10028957 17.5 0.6778
AT5G03300 ADK2 adenosine kinase 2 (.1) Lus10023197 17.5 0.5721
AT1G77170 Tetratricopeptide repeat (TPR)... Lus10029884 20.1 0.6422
AT1G17665 unknown protein Lus10006153 22.4 0.6651
AT4G11080 3xHMG-box1 3xHigh Mobility Group-box1, HM... Lus10033954 23.6 0.6515

Lus10020494 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.