Lus10020497 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G70840 149 / 3e-46 MLP31 MLP-like protein 31 (.1)
AT1G70890 147 / 9e-46 MLP43 MLP-like protein 43 (.1)
AT1G70830 145 / 4e-45 MLP28 MLP-like protein 28 (.1.2.3.4.5)
AT1G70850 147 / 9e-45 MLP34 MLP-like protein 34 (.1.2.3)
AT5G28010 140 / 4e-43 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G70880 122 / 8e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT5G28000 115 / 4e-33 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G23130 112 / 6e-32 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G35260 93 / 1e-24 MLP165 MLP-like protein 165 (.1)
AT1G35310 86 / 1e-21 MLP168 MLP-like protein 168 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020498 209 / 3e-70 AT1G70830 160 / 7e-51 MLP-like protein 28 (.1.2.3.4.5)
Lus10012466 209 / 3e-70 AT1G70830 161 / 3e-51 MLP-like protein 28 (.1.2.3.4.5)
Lus10012742 205 / 1e-68 AT1G70830 158 / 6e-50 MLP-like protein 28 (.1.2.3.4.5)
Lus10042490 83 / 2e-20 AT1G14930 107 / 3e-30 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10008932 84 / 5e-20 AT4G14060 127 / 1e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10028887 81 / 6e-20 AT2G01520 129 / 1e-38 \(Zusammen-CA\)-enhanced 1, MLP-like protein 328 (.1)
Lus10033397 80 / 2e-19 AT1G14950 121 / 1e-35 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10008930 79 / 3e-19 AT5G28010 126 / 2e-37 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10002644 69 / 5e-16 AT1G70850 58 / 1e-11 MLP-like protein 34 (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G111000 197 / 1e-65 AT1G70830 175 / 8e-57 MLP-like protein 28 (.1.2.3.4.5)
Potri.017G051200 115 / 9e-34 AT1G70840 116 / 3e-34 MLP-like protein 31 (.1)
Potri.017G051100 113 / 1e-32 AT1G70840 115 / 3e-33 MLP-like protein 31 (.1)
Potri.008G131300 100 / 2e-27 AT1G14930 100 / 1e-27 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.008G131100 89 / 4e-23 AT1G70890 107 / 3e-30 MLP-like protein 43 (.1)
Potri.008G131200 86 / 8e-22 AT1G14930 122 / 4e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.010G096000 67 / 2e-14 AT1G24020 188 / 3e-62 MLP-like protein 423 (.1.2)
Potri.004G020000 45 / 3e-06 AT1G70880 69 / 3e-15 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.004G051500 44 / 5e-06 AT5G28010 69 / 4e-15 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.011G025966 44 / 9e-06 AT1G24020 55 / 7e-10 MLP-like protein 423 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF00407 Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence
>Lus10020497 pacid=23139575 polypeptide=Lus10020497 locus=Lus10020497.g ID=Lus10020497.BGIv1.0 annot-version=v1.0
ATGAGCACTCTTCTTCTGAAAGGCAAGGCGGAGGCACAGTTTGCCATCAGACTTGCTGCAAAAGAATTCCACAGCATCTTCAGTGCCAGACCTCACCATG
TCTCCAACATGGCCCCTAACAAGATCAAGAACTGCGCTATGCATCAAGGCGAATGGGGCAAAAAGGGCACCATCCTTGTCTGGGATTACGTCCATGACGG
GGTTGCGAAGGTGGCCAAGGAAGTAATCGAGGAGATAGACGAGGCGAATCTGTCGACGACATTCAAGGTGATTGAAGGGGATATAACAAAGGATTACAAG
GAGTTTAAGATAACTGTGAAGGCGACTCCTCAATCCGCGGAGACAAGTCTGATCCAGTGGACGCTGGAGTATGAGAAGCTCCGTGAGGACTTTCCTGACA
CCGATGCCATCTCCCTTCTGAACTTTGTCGTCCACATGAGCAAAGACATTGATGATCACCACACCAACCGAAACAACTAG
AA sequence
>Lus10020497 pacid=23139575 polypeptide=Lus10020497 locus=Lus10020497.g ID=Lus10020497.BGIv1.0 annot-version=v1.0
MSTLLLKGKAEAQFAIRLAAKEFHSIFSARPHHVSNMAPNKIKNCAMHQGEWGKKGTILVWDYVHDGVAKVAKEVIEEIDEANLSTTFKVIEGDITKDYK
EFKITVKATPQSAETSLIQWTLEYEKLREDFPDTDAISLLNFVVHMSKDIDDHHTNRNN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G70840 MLP31 MLP-like protein 31 (.1) Lus10020497 0 1
AT2G02850 ARPN plantacyanin (.1) Lus10022800 2.0 0.9779
AT3G28050 nodulin MtN21 /EamA-like trans... Lus10039478 3.2 0.9778
AT3G07680 emp24/gp25L/p24 family/GOLD fa... Lus10036603 4.5 0.9677
AT1G16390 3-Oct, ATOCT3 organic cation/carnitine trans... Lus10005825 5.5 0.9532
AT1G14160 Uncharacterised protein family... Lus10036770 5.7 0.9649
AT3G44710 Plant protein of unknown funct... Lus10020562 5.9 0.9676
AT3G53980 Bifunctional inhibitor/lipid-t... Lus10040249 7.2 0.9448
AT4G16740 ATTPS03 terpene synthase 03 (.1.2) Lus10012312 7.2 0.9629
AT2G46680 HD ATHB7, ATHB-7 ARABIDOPSIS THALIANA HOMEOBOX ... Lus10008840 7.7 0.9675
AT1G14160 Uncharacterised protein family... Lus10037160 8.3 0.9684

Lus10020497 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.