Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04400 251 / 6e-88 EMB2171 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) AT2G33370 251 / 7e-88 Ribosomal protein L14p/L23e family protein (.1) AT1G04480 251 / 7e-88 Ribosomal protein L14p/L23e family protein (.1) ATCG00780 67 / 2e-15 ATCG00780.1, RPL14 ribosomal protein L14 (.1) AT1G17560 42 / 2e-05 HLL HUELLENLOS, Ribosomal protein L14p/L23e family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042695 [exp] 253 / 3e-88 AT2G33370 273 / 8e-96 Ribosomal protein L14p/L23e family protein (.1) Lus10012464 [exp] 252 / 3e-88 AT3G04400 251 / 6e-88 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Lus10023730 [exp] 252 / 3e-88 AT2G33370 278 / 3e-98 Ribosomal protein L14p/L23e family protein (.1) Lus10011773 [exp] 254 / 4e-88 AT2G33370 270 / 2e-94 Ribosomal protein L14p/L23e family protein (.1) Lus10022881 [exp] 252 / 2e-87 AT1G04480 270 / 1e-94 Ribosomal protein L14p/L23e family protein (.1) Lus10024943 [exp] 251 / 3e-87 AT1G04480 270 / 2e-94 Ribosomal protein L14p/L23e family protein (.1) Lus10024942 [exp] 215 / 6e-74 AT2G33370 214 / 1e-73 Ribosomal protein L14p/L23e family protein (.1) Lus10022882 [exp] 215 / 6e-74 AT3G04400 214 / 1e-73 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Lus10008065 [exp] 91 / 2e-25 AT1G04480 91 / 6e-26 Ribosomal protein L14p/L23e family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G171200 [exp] 252 / 2e-88 AT3G04400 278 / 3e-98 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Potri.010G066400 [exp] 252 / 2e-88 AT3G04400 278 / 3e-98 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Potri.002G257500 [exp] 252 / 2e-88 AT3G04400 278 / 3e-98 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Potri.011G127250 [exp] 191 / 5e-64 AT3G04400 189 / 2e-63 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Potri.010G167700 [exp] 162 / 5e-53 AT3G04400 160 / 9e-53 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Potri.003G136400 [exp] 158 / 1e-51 AT3G04400 157 / 2e-51 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Potri.004G166200 [exp] 157 / 2e-51 AT3G04400 156 / 5e-51 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Potri.010G022800 [exp] 43 / 6e-06 AT5G46160 199 / 3e-66 Ribosomal protein L14p/L23e family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00238 [flax] [poplar] Ribosomal_L14 Ribosomal protein L14p/L23e
Representative CDS sequence Show only first row Show all	>Lus10020499 pacid=23139547 polypeptide=Lus10020499 locus=Lus10020499.g ID=Lus10020499.BGIv1.0 annot-version=v1.0 ATGTCCCTTGGACTTCCGGTGGCCGCGACGGTCAACTGTGCCGACAACACCGGGGCGAAGAACCTGTACATCATCTCCGTGAAAGGAATCAAAGGTAGAC TCAACAGGCTGCCCTCAGCTTGCGTCGGGGACATGGTGATGGCAACGGTGAAGAAGGGGAAGCCCGATCTCAGGAAGAAGGTGATGCCTGCTGTCATTGT CAGGCAGCGCAAGCCTTGGCGCCGAAAGGATGGTGTCTTCATGTACTTCGAAGATAATGCTGGTGTGATTGTGAACCCCAAAGGAGAAATGAAGGGATCT GCTATCACTGGCCCTATCGGAAAGGAGTGTGCTGATTTGTGGCCTAGGATTGCTAGTGCAGCAAACGCCATTGTCTAA
AA sequence Show only first row Show all	>Lus10020499 pacid=23139547 polypeptide=Lus10020499 locus=Lus10020499.g ID=Lus10020499.BGIv1.0 annot-version=v1.0 MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGS AITGPIGKECADLWPRIASAANAIV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G04480			Ribosomal protein L14p/L23e fa...		Lus10020499 [exp]	0	1
AT5G56710			Ribosomal protein L31e family ...		Lus10015698 [exp]	1.4	0.9630
AT3G11510			Ribosomal protein S11 family p...		Lus10022693 [exp]	4.7	0.9522
AT1G13690		ATE1	ATPase E1 (.1)		Lus10004641 [exp]	4.9	0.9442
AT3G16780			Ribosomal protein L19e family ...		Lus10016829 [exp]	6.0	0.9404
AT5G56710			Ribosomal protein L31e family ...		Lus10037703 [exp]	6.9	0.9359
AT5G20500			Glutaredoxin family protein (....		Lus10017148 [exp]	7.4	0.9284
AT2G32060			Ribosomal protein L7Ae/L30e/S1...		Lus10027800 [exp]	7.7	0.9480
AT1G26340		B5 #6, B5#6, AT...	ARABIDOPSIS CYTOCHROME B5 ISOF...		Lus10036973 [exp]	8.6	0.8986
AT3G52300		ATPQ	"ATP synthase D chain, mitocho...		Lus10040374 [exp]	10.0	0.9183
AT5G27700			Ribosomal protein S21e (.1)		Lus10015173 [exp]	11.2	0.9406

Compare expression of checked genes

Lus10020499 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.