Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04010 127 / 2e-36 O-Glycosyl hydrolases family 17 protein (.1) AT1G64760 125 / 1e-35 O-Glycosyl hydrolases family 17 protein (.1.2) AT2G19440 123 / 6e-35 O-Glycosyl hydrolases family 17 protein (.1) AT5G18220 118 / 7e-33 O-Glycosyl hydrolases family 17 protein (.1) AT5G64790 101 / 1e-26 O-Glycosyl hydrolases family 17 protein (.1) AT3G24330 99 / 8e-26 O-Glycosyl hydrolases family 17 protein (.1) AT5G58480 82 / 1e-19 O-Glycosyl hydrolases family 17 protein (.1) AT5G20870 80 / 4e-19 O-Glycosyl hydrolases family 17 protein (.1) AT4G31140 79 / 7e-19 O-Glycosyl hydrolases family 17 protein (.1) AT5G58090 79 / 7e-19 O-Glycosyl hydrolases family 17 protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031098 [exp] 161 / 5e-49 AT1G64760 694 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10020261 [exp] 124 / 3e-35 AT1G64760 676 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10002633 [exp] 119 / 4e-33 AT1G64760 681 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10039095 [exp] 89 / 2e-22 AT4G17180 727 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Lus10024535 [exp] 83 / 4e-20 AT4G31140 627 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Lus10028104 [exp] 82 / 7e-20 AT5G58090 729 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Lus10040579 [exp] 82 / 8e-20 AT5G58090 729 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Lus10006811 [exp] 81 / 2e-19 AT5G64790 565 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Lus10017740 [exp] 80 / 4e-19 AT3G24330 540 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G059700 [exp] 119 / 3e-33 AT1G64760 701 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Potri.019G032900 [exp] 118 / 7e-33 AT1G64760 698 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Potri.018G000900 [exp] 95 / 2e-24 AT4G31140 667 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Potri.007G078900 [exp] 92 / 1e-23 AT5G64790 528 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Potri.006G280700 [exp] 91 / 5e-23 AT4G31140 676 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Potri.018G072300 [exp] 90 / 1e-22 AT3G24330 647 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Potri.016G002800 [exp] 90 / 2e-22 AT4G17180 704 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Potri.009G076500 [exp] 89 / 3e-22 AT5G58480 630 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Potri.006G002100 [exp] 89 / 3e-22 AT4G17180 711 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Potri.006G280400 [exp] 85 / 1e-21 AT4G31140 351 / 4e-120 O-Glycosyl hydrolases family 17 protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0058 [flax] [poplar] Glyco_hydro_tim PF00332 [flax] [poplar] Glyco_hydro_17 Glycosyl hydrolases family 17
Representative CDS sequence Show only first row Show all	>Lus10020526 pacid=23172383 polypeptide=Lus10020526 locus=Lus10020526.g ID=Lus10020526.BGIv1.0 annot-version=v1.0 ATGGCTACCCATCAGTTGCCACCCAAGACAGTGGTGGAGATGCTCAAGGCTAATGAGCTTCAGAAGGTGAAGCTTTTTGATGCTGATGCCAGAACCATGG ATGCTCTTGCCGGGAGTAACACCAAGGTTATGGTGGCCATTCCTAATGATCAGCTTCAAGCTATGAATGACAAAGACACTGCGAAAGATTGGGTTAAGAG GAATGTTACTCGTTACACCTTCAATGTAGGTGTTAATATCAAGTATGTGGCAGTTTGA
AA sequence Show only first row Show all	>Lus10020526 pacid=23172383 polypeptide=Lus10020526 locus=Lus10020526.g ID=Lus10020526.BGIv1.0 annot-version=v1.0 MATHQLPPKTVVEMLKANELQKVKLFDADARTMDALAGSNTKVMVAIPNDQLQAMNDKDTAKDWVKRNVTRYTFNVGVNIKYVAV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G64760			O-Glycosyl hydrolases family 1...		Lus10020526 [exp]	0	1
AT1G15380		GLYI4	glyoxylase I 4, Lactoylglutath...		Lus10025971 [exp]	3.5	0.8628
AT3G07420		ATNS2, SYNC2_AR...	SYNTHETASE C2, asparaginyl-tRN...		Lus10038228 [exp]	4.0	0.8371
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Lus10007348 [exp]	7.7	0.8625
AT1G17020		ATSRG1, SRG1	senescence-related gene 1 (.1)		Lus10030995 [exp]	7.7	0.8565
AT3G15200			Tetratricopeptide repeat (TPR)...		Lus10031270 [exp]	9.3	0.8618
AT3G56400	WRKY	ATWRKY70, WRKY7...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10034244 [exp]	11.3	0.8575
AT5G60920		COB	COBRA-like extracellular glyco...		Lus10017861 [exp]	12.0	0.8562
AT4G21440	MYB	ATMYB102, ATM4	A. THALIANA MYB 4, MYB-like 10...		Lus10018547 [exp]	15.7	0.8089
AT2G23140			RING/U-box superfamily protein...		Lus10011516 [exp]	18.2	0.8051
AT2G46330		ATAGP16, AGP16	arabinogalactan protein 16 (.1...		Lus10024263 [exp]	18.9	0.8487

Compare expression of checked genes

Lus10020526 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.