Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G44750 121 / 2e-35 HDT1, HDA3, ATHD2A, HD2A HISTONE DEACETYLASE 2A, histone deacetylase 3 (.1.2) AT5G03740 108 / 6e-30 C2H2ZnF HD2C, HDT3 HISTONE DEACETYLASE 3, histone deacetylase 2C (.1) AT5G22650 99 / 3e-26 ATHD2B, HDT2, HDT02, HDA4, HD2B ARABIDOPSIS HISTONE DEACETYLASE 2, histone deacetylase 2B (.1.2) AT2G27840 71 / 4e-16 HDT04, HDA13, HDT4 HISTONE DEACETYLASE 13, histone deacetylase-related / HD-related (.1.2) AT3G12340 40 / 0.0001 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009390 [exp] 175 / 9e-56 AT3G44750 166 / 1e-50 HISTONE DEACETYLASE 2A, histone deacetylase 3 (.1.2) Lus10009391 [exp] 159 / 2e-48 AT2G27830 130 / 7e-36 unknown protein Lus10020543 [exp] 132 / 1e-39 AT5G22650 136 / 1e-38 ARABIDOPSIS HISTONE DEACETYLASE 2, histone deacetylase 2B (.1.2) Lus10003376 [exp] 130 / 2e-38 AT3G44750 114 / 2e-30 HISTONE DEACETYLASE 2A, histone deacetylase 3 (.1.2) Lus10002846 [exp] 124 / 2e-35 AT3G44750 105 / 4e-26 HISTONE DEACETYLASE 2A, histone deacetylase 3 (.1.2) Lus10018845 [exp] 41 / 6e-05 AT3G12340 114 / 3e-29 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G149400 [exp] 152 / 4e-47 AT3G44750 126 / 5e-35 HISTONE DEACETYLASE 2A, histone deacetylase 3 (.1.2) Potri.004G188800 [exp] 147 / 5e-45 AT3G44750 122 / 1e-33 HISTONE DEACETYLASE 2A, histone deacetylase 3 (.1.2) Potri.006G116500 [exp] 132 / 4e-39 AT5G03740 117 / 8e-31 HISTONE DEACETYLASE 3, histone deacetylase 2C (.1) Potri.007G000500 [exp] 46 / 1e-06 AT3G12340 149 / 1e-38 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020542 pacid=23172323 polypeptide=Lus10020542 locus=Lus10020542.g ID=Lus10020542.BGIv1.0 annot-version=v1.0 ATGGCTTCGATGATGTTTTGGGGTGTTGAGGTCAAGGCCGGTGAGCCTCTTAAAGTGACTCCTGATGATGATTTCATCCTTCATCTATCACAAGCTGCAC TTGGAGAGTCTAAGAAGGGCAAAGCTGAGTCGGCGACTCTTTCTGTCACTGTCGATGGCAAGAAGCTCGTGTTGGGAACACTCTCCGCTGAGAACATCCC CCAGATGCAGTTTGATCTCGTGTTTGAGAAGGAGTTTGAGCTGTCCCATAACTGGAAGAGTGGAAGTGTCTTCTTCACTGGCTACAAATCTGTCCTCCCG GATGATGAATATCCTTTCTTTTCAATATGTTTTGAAATATTGTGA
AA sequence Show only first row Show all	>Lus10020542 pacid=23172323 polypeptide=Lus10020542 locus=Lus10020542.g ID=Lus10020542.BGIv1.0 annot-version=v1.0 MASMMFWGVEVKAGEPLKVTPDDDFILHLSQAALGESKKGKAESATLSVTVDGKKLVLGTLSAENIPQMQFDLVFEKEFELSHNWKSGSVFFTGYKSVLP DDEYPFFSICFEIL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G44750		HDT1, HDA3, ATH...	HISTONE DEACETYLASE 2A, histon...		Lus10020542 [exp]	0	1
AT3G18600			P-loop containing nucleoside t...		Lus10027240 [exp]	1.0	0.9424
AT3G44750		HDT1, HDA3, ATH...	HISTONE DEACETYLASE 2A, histon...		Lus10009390 [exp]	2.0	0.9384
AT5G41970			Metal-dependent protein hydrol...		Lus10000877 [exp]	3.5	0.9195
AT3G18600			P-loop containing nucleoside t...		Lus10038950 [exp]	3.5	0.9033
AT4G02930			GTP binding Elongation factor ...		Lus10008161 [exp]	5.2	0.9252
AT1G63660			GMP synthase (glutamine-hydrol...		Lus10032268 [exp]	6.3	0.9101
AT5G52380			VASCULAR-RELATED NAC-DOMAIN 6 ...		Lus10027475 [exp]	7.3	0.8380
AT5G03740	C2H2ZnF	HD2C, HDT3	HISTONE DEACETYLASE 3, histone...		Lus10020541 [exp]	7.5	0.9010
AT2G17250		EMB2762	EMBRYO DEFECTIVE 2762, CCAAT-b...		Lus10022991 [exp]	7.7	0.8669
AT3G04770		RPSAB	40s ribosomal protein SA B (.1...		Lus10018284 [exp]	12.7	0.9001

Compare expression of checked genes

Lus10020542 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.