Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G44735 55 / 7e-12 PSK1, ATPSK3 PHYTOSULFOKINE 3 PRECURSOR (.1.2) AT4G37720 35 / 0.0008 ATPSK6, ATPSK4 phytosulfokine 6 precursor (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027716 [exp] 50 / 7e-10 AT3G44735 57 / 4e-12 PHYTOSULFOKINE 3 PRECURSOR (.1.2) Lus10035572 [exp] 42 / 1e-06 AT3G44735 54 / 4e-11 PHYTOSULFOKINE 3 PRECURSOR (.1.2) Lus10030916 [exp] 38 / 4e-05 AT1G13590 56 / 8e-12 phytosulfokine 1 precursor (.1) Lus10011721 [exp] 37 / 0.0001 AT3G49780 53 / 3e-10 phytosulfokine 4 precursor (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G148900 [exp] 54 / 1e-11 AT3G44735 65 / 2e-15 PHYTOSULFOKINE 3 PRECURSOR (.1.2) Potri.004G188200 [exp] 54 / 3e-11 AT3G44735 69 / 9e-17 PHYTOSULFOKINE 3 PRECURSOR (.1.2) Potri.009G085600 [exp] 41 / 2e-06 AT3G49780 68 / 1e-16 phytosulfokine 4 precursor (.1) Potri.007G006800 [exp] 38 / 3e-05 AT3G49780 60 / 1e-13 phytosulfokine 4 precursor (.1) Potri.014G006900 [exp] 35 / 0.0007 AT2G22860 52 / 2e-10 phytosulfokine 2 precursor (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06404 [flax] [poplar] PSK Phytosulfokine precursor protein (PSK)
Representative CDS sequence Show only first row Show all	>Lus10020548 pacid=23172328 polypeptide=Lus10020548 locus=Lus10020548.g ID=Lus10020548.BGIv1.0 annot-version=v1.0 ATGTTCATCTCCTCCTCCTCCGCTGCTCGTCCTTTCTCCGACGTTCCAGCTGCAGCAGGGGAAGATCGCGACGAATCAGCTGAATCAATGGAGCTGATGG GGATGGGCATGAAGAAATGCGATGAAGATGAAGATGAATGCTTGAAGAGGAGAGTGATTTCAGAGGCTCACTTGGATTATATCTACACCCAGCACCATTG A
AA sequence Show only first row Show all	>Lus10020548 pacid=23172328 polypeptide=Lus10020548 locus=Lus10020548.g ID=Lus10020548.BGIv1.0 annot-version=v1.0 MFISSSSAARPFSDVPAAAGEDRDESAESMELMGMGMKKCDEDEDECLKRRVISEAHLDYIYTQHH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G44735		PSK1, ATPSK3	PHYTOSULFOKINE 3 PRECURSOR (.1...		Lus10020548 [exp]	0	1

Compare expression of checked genes

Lus10020548 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.