Lus10020552 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G44860 240 / 2e-82 Ribosomal protein L24e family protein (.1.2)
AT3G53020 82 / 4e-20 RPL24B, STV1 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
AT2G36620 81 / 1e-19 RPL24A ribosomal protein L24 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009403 143 / 3e-42 AT2G44860 120 / 2e-33 Ribosomal protein L24e family protein (.1.2)
Lus10008640 81 / 9e-20 AT2G36620 243 / 1e-83 ribosomal protein L24 (.1)
Lus10035584 81 / 1e-19 AT2G36620 241 / 5e-83 ribosomal protein L24 (.1)
Lus10024560 79 / 9e-19 AT2G36620 238 / 2e-81 ribosomal protein L24 (.1)
Lus10032198 79 / 1e-18 AT2G36620 240 / 1e-82 ribosomal protein L24 (.1)
Lus10006314 77 / 2e-17 AT2G36620 233 / 2e-78 ribosomal protein L24 (.1)
Lus10029583 77 / 2e-17 AT2G36620 232 / 4e-78 ribosomal protein L24 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G148500 246 / 1e-84 AT2G44860 248 / 1e-85 Ribosomal protein L24e family protein (.1.2)
Potri.004G187800 245 / 3e-84 AT2G44860 249 / 8e-86 Ribosomal protein L24e family protein (.1.2)
Potri.004G085300 83 / 1e-20 AT3G53020 199 / 2e-66 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.012G139400 82 / 3e-20 AT3G53020 227 / 3e-77 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.012G139500 82 / 3e-20 AT3G53020 227 / 3e-77 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.015G141900 82 / 4e-20 AT3G53020 196 / 3e-65 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.003G123101 81 / 8e-20 AT3G53020 218 / 8e-74 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0175 TRASH PF01246 Ribosomal_L24e Ribosomal protein L24e
Representative CDS sequence
>Lus10020552 pacid=23172308 polypeptide=Lus10020552 locus=Lus10020552.g ID=Lus10020552.BGIv1.0 annot-version=v1.0
ATGAGGTTGGAGAATTGCTGGTTTTGTTCGTCGAAGATATACCCTGGGCATGGTATCCAATTCGTTCGCAACGATGCTAAGATCTTTAGGTTCTGTAGGT
CTAAATGCCACAAGAACTTCAAGATGAAGAGAAATCCAAGGAAGGTAAAATGGACCAAGGCCTATAGGAAGCTGCACGGAAAGGATATGACAAAGGATTC
AACCTTTGAGTTCGAGAGGAAGAGGAACAGGCCCGATAGATACGACAGAAACGTCGTCGAAAACACCCTCAACGCCATCAAGAAGATCAGCAAAATCCGA
AACGAAAGGGAACACAAGCACATCACGAACAGGTTGAAGGTGAGCAAGATCAAGAATCACAAAGAGGCGGTTAAGGAACTTGATCAGAGCATCCACCTTA
TCCATGCGCCAGCTGGTATCAGAGTCACGAAGGATGTCGTTAAAGTTCCCGTACCACAACAAACTGCGGAGAATCGACCGATGGAGGAGTAG
AA sequence
>Lus10020552 pacid=23172308 polypeptide=Lus10020552 locus=Lus10020552.g ID=Lus10020552.BGIv1.0 annot-version=v1.0
MRLENCWFCSSKIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRKLHGKDMTKDSTFEFERKRNRPDRYDRNVVENTLNAIKKISKIR
NEREHKHITNRLKVSKIKNHKEAVKELDQSIHLIHAPAGIRVTKDVVKVPVPQQTAENRPMEE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G44860 Ribosomal protein L24e family ... Lus10020552 0 1
AT5G56670 Ribosomal protein S30 family p... Lus10017473 2.4 0.9181
AT3G09500 Ribosomal L29 family protein ... Lus10003306 4.6 0.9050
AT2G46230 PIN domain-like family protein... Lus10012649 6.9 0.8982
AT1G07830 ribosomal protein L29 family p... Lus10024720 7.1 0.8646
AT3G10530 Transducin/WD40 repeat-like su... Lus10035742 8.0 0.8910
AT3G11500 Small nuclear ribonucleoprotei... Lus10017019 8.1 0.9009
AT4G14320 Zinc-binding ribosomal protein... Lus10010195 9.1 0.9058
AT5G23535 KOW domain-containing protein ... Lus10022069 11.8 0.9015
AT1G80750 Ribosomal protein L30/L7 famil... Lus10019603 12.2 0.8774
AT1G25260 Ribosomal protein L10 family p... Lus10043280 13.7 0.8950

Lus10020552 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.