Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G22580 133 / 8e-42 Stress responsive A/B Barrel Domain (.1) AT3G17210 74 / 2e-18 ATHS1 A. THALIANA HEAT STABLE PROTEIN 1, heat stable protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009407 [exp] 203 / 2e-69 AT5G22580 122 / 2e-37 Stress responsive A/B Barrel Domain (.1) Lus10037823 [exp] 67 / 2e-15 AT3G17210 170 / 1e-56 A. THALIANA HEAT STABLE PROTEIN 1, heat stable protein 1 (.1) Lus10000094 [exp] 58 / 5e-12 AT3G17210 162 / 6e-53 A. THALIANA HEAT STABLE PROTEIN 1, heat stable protein 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G148100 [exp] 150 / 9e-49 AT5G22580 118 / 7e-36 Stress responsive A/B Barrel Domain (.1) Potri.004G187500 [exp] 147 / 3e-47 AT5G22580 134 / 3e-42 Stress responsive A/B Barrel Domain (.1) Potri.010G037500 [exp] 78 / 4e-20 AT3G17210 170 / 2e-56 A. THALIANA HEAT STABLE PROTEIN 1, heat stable protein 1 (.1) Potri.010G037200 [exp] 76 / 1e-18 AT3G17210 169 / 4e-55 A. THALIANA HEAT STABLE PROTEIN 1, heat stable protein 1 (.1) Potri.010G150900 [exp] 73 / 7e-18 AT3G17210 146 / 8e-47 A. THALIANA HEAT STABLE PROTEIN 1, heat stable protein 1 (.1) Potri.010G151000 [exp] 69 / 2e-16 AT3G17210 134 / 3e-42 A. THALIANA HEAT STABLE PROTEIN 1, heat stable protein 1 (.1) Potri.010G150800 [exp] 55 / 6e-11 AT3G17210 92 / 1e-25 A. THALIANA HEAT STABLE PROTEIN 1, heat stable protein 1 (.1) Potri.010G150500 [exp] 52 / 7e-10 AT3G17210 100 / 5e-29 A. THALIANA HEAT STABLE PROTEIN 1, heat stable protein 1 (.1) Potri.010G151200 [exp] 39 / 6e-05 AT3G17210 92 / 1e-25 A. THALIANA HEAT STABLE PROTEIN 1, heat stable protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0032 [flax] [poplar] Dim_A_B_barrel PF07876 [flax] [poplar] Dabb Stress responsive A/B Barrel Domain
Representative CDS sequence Show only first row Show all	>Lus10020555 pacid=23172304 polypeptide=Lus10020555 locus=Lus10020555.g ID=Lus10020555.BGIv1.0 annot-version=v1.0 ATGGCTGCTCCAGAGTTCAAGCACTTGGCAATCATCAAGTTCAAAGAAGGTGTTGTGGTGGATGAGATGATCAAAGGGATGGAGAAGCTTGTCTCTCAGA TCTCTCTCATCAAGTCCTTGGAATGGGGACAGGATCTGGAAGGGCATGAGATGCTGACACAAGGGTTCACACATGCATTCACACTGACATTCAACAGCAA GGAAGACTACATTGCTTATGAGAATCATCCAACCCACCTTGAGTATGCAGCTGGGTTCTCTGCAAGTATTGAGAAATTTGTGGTGCTCAACTACCCTACT GTTCTTCTCAAGCAGACCTGA
AA sequence Show only first row Show all	>Lus10020555 pacid=23172304 polypeptide=Lus10020555 locus=Lus10020555.g ID=Lus10020555.BGIv1.0 annot-version=v1.0 MAAPEFKHLAIIKFKEGVVVDEMIKGMEKLVSQISLIKSLEWGQDLEGHEMLTQGFTHAFTLTFNSKEDYIAYENHPTHLEYAAGFSASIEKFVVLNYPT VLLKQT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G22580			Stress responsive A/B Barrel D...		Lus10020555 [exp]	0	1
AT2G41110		ACAM-2, ATCAL5,...	calmodulin 2 (.1.2)		Lus10021487 [exp]	1.4	0.9568
AT4G19510			Disease resistance protein (TI...		Lus10008209 [exp]	2.0	0.9547
AT1G69580	GARP		Homeodomain-like superfamily p...		Lus10036758 [exp]	2.6	0.9286
AT3G44735		PSK1, ATPSK3	PHYTOSULFOKINE 3 PRECURSOR (.1...		Lus10035572 [exp]	3.2	0.9396
AT2G15680		AtCML30	calmodulin-like 30, Calcium-bi...		Lus10014050 [exp]	3.5	0.9479
					Lus10025141 [exp]	3.5	0.9479
AT5G59320		LTP3	lipid transfer protein 3 (.1)		Lus10024201 [exp]	4.9	0.9367
					Lus10025225 [exp]	6.9	0.9255
AT5G08350			GRAM domain-containing protein...		Lus10017372 [exp]	7.7	0.8956
AT3G17220		ATPMEI2	pectin methylesterase inhibito...		Lus10017347 [exp]	8.1	0.9199

Compare expression of checked genes

Lus10020555 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.