Lus10020558 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G18770 54 / 5e-10 RING/U-box superfamily protein (.1)
AT1G18760 54 / 2e-09 Zinc finger, C3HC4 type (RING finger) family protein (.1)
AT1G18780 54 / 2e-09 RING/U-box superfamily protein (.1)
AT2G29840 54 / 4e-09 RING/U-box superfamily protein (.1)
AT3G46620 51 / 4e-08 zinc finger (C3HC4-type RING finger) family protein (.1)
AT1G21960 50 / 4e-08 RING/U-box superfamily protein (.1)
AT3G13228 50 / 5e-08 RING/U-box superfamily protein (.1)
AT1G74620 50 / 6e-08 RING/U-box superfamily protein (.1)
AT5G59550 50 / 1e-07 zinc finger (C3HC4-type RING finger) family protein (.1)
AT3G19950 50 / 1e-07 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006279 155 / 5e-48 AT1G18760 62 / 2e-11 Zinc finger, C3HC4 type (RING finger) family protein (.1)
Lus10034793 106 / 1e-29 AT5G59550 48 / 9e-07 zinc finger (C3HC4-type RING finger) family protein (.1)
Lus10007628 92 / 6e-23 AT4G12140 60 / 2e-10 RING/U-box superfamily protein (.1)
Lus10012376 86 / 9e-22 AT3G46620 60 / 3e-11 zinc finger (C3HC4-type RING finger) family protein (.1)
Lus10028009 79 / 3e-19 AT5G59550 57 / 5e-10 zinc finger (C3HC4-type RING finger) family protein (.1)
Lus10033682 66 / 6e-14 AT3G19950 67 / 5e-13 RING/U-box superfamily protein (.1)
Lus10017722 64 / 3e-13 AT3G19950 64 / 5e-12 RING/U-box superfamily protein (.1)
Lus10030464 61 / 6e-12 AT1G26800 181 / 3e-57 RING/U-box superfamily protein (.1)
Lus10012819 59 / 3e-11 AT1G26800 182 / 6e-58 RING/U-box superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G118000 59 / 3e-11 AT1G18760 81 / 1e-18 Zinc finger, C3HC4 type (RING finger) family protein (.1)
Potri.007G107000 59 / 5e-11 AT1G18760 79 / 7e-18 Zinc finger, C3HC4 type (RING finger) family protein (.1)
Potri.001G103900 55 / 1e-09 AT4G26400 85 / 2e-19 RING/U-box superfamily protein (.1.2)
Potri.010G168300 50 / 4e-08 AT1G26800 195 / 4e-63 RING/U-box superfamily protein (.1)
Potri.002G083001 50 / 7e-08 AT1G18760 81 / 1e-18 Zinc finger, C3HC4 type (RING finger) family protein (.1)
Potri.005G062400 49 / 9e-08 AT1G60360 82 / 3e-18 RING/U-box superfamily protein (.1)
Potri.013G116000 49 / 1e-07 AT3G30460 61 / 2e-11 RING/U-box superfamily protein (.1)
Potri.008G087200 49 / 1e-07 AT1G26800 194 / 6e-63 RING/U-box superfamily protein (.1)
Potri.016G082500 49 / 2e-07 AT5G02750 176 / 1e-53 SHOOT GRAVITROPISM 9, RING/U-box superfamily protein (.1)
Potri.005G090500 47 / 1e-06 AT3G19950 279 / 4e-93 RING/U-box superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10020558 pacid=23172325 polypeptide=Lus10020558 locus=Lus10020558.g ID=Lus10020558.BGIv1.0 annot-version=v1.0
ATGACGCCACGTCTGCAATTGGTGACAGAATTCCATCTAGCAGAGGAAACGGCGGTGGTGATGCCACCTCCTCAGGCGGCGCGTGGGCAAAGGAGGAGGC
GATTCCGTTACGTACGAGAAGAATTCGCGGCCGAATTCCGTGATCAGAGGGAGGCGGTGGTGGCGGAATCCGCCGAAGAATACGAGATGAGGACTACCGG
CGCTTCGGAATTGGCAATTCAGAAGCTGGAGAGGGTGGAGATCGGCTGCGGGTGCGGCGGAGAGTGGAAACAGGGTGATTGCTGCACAATTTGTCTTGAG
GAGATGGGTTCCGGCGAAGGAAAGGTGATAAGGTTTGATTGCAAGCATGAGTTCAATGGAAGTTTCTTGATTACTTGGCTTCAGCAATCGAATTGCTGCC
CATTGTGCCGATTTCAGATTCCAGGTTCATAG
AA sequence
>Lus10020558 pacid=23172325 polypeptide=Lus10020558 locus=Lus10020558.g ID=Lus10020558.BGIv1.0 annot-version=v1.0
MTPRLQLVTEFHLAEETAVVMPPPQAARGQRRRRFRYVREEFAAEFRDQREAVVAESAEEYEMRTTGASELAIQKLERVEIGCGCGGEWKQGDCCTICLE
EMGSGEGKVIRFDCKHEFNGSFLITWLQQSNCCPLCRFQIPGS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G18760 Zinc finger, C3HC4 type (RING ... Lus10020558 0 1
Lus10025095 11.9 0.6874
AT3G06330 RING/U-box superfamily protein... Lus10012793 14.5 0.6568
AT3G22680 RDM1 RNA-DIRECTED DNA METHYLATION 1... Lus10003012 17.0 0.6793
AT1G28030 2-oxoglutarate (2OG) and Fe(II... Lus10012760 21.0 0.6770
AT1G74670 GASA6 GA-stimulated Arabidopsis 6, G... Lus10024216 25.8 0.6641
Lus10023587 28.8 0.6641
AT2G25470 AtRLP21 receptor like protein 21 (.1) Lus10027855 31.6 0.6641
AT3G19540 Protein of unknown function (D... Lus10028040 34.1 0.6641
Lus10021782 36.4 0.6641
AT3G20800 Cell differentiation, Rcd1-lik... Lus10031542 38.7 0.6641

Lus10020558 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.