Lus10020569 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G21105 114 / 2e-34 cytochrome-c oxidases;electron carriers (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006276 145 / 1e-46 AT4G21105 113 / 5e-35 cytochrome-c oxidases;electron carriers (.1.2)
Lus10006275 139 / 2e-44 AT4G21105 115 / 7e-36 cytochrome-c oxidases;electron carriers (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G460200 121 / 4e-37 AT4G21105 116 / 2e-36 cytochrome-c oxidases;electron carriers (.1.2)
Potri.011G156400 114 / 1e-34 AT4G21105 117 / 2e-36 cytochrome-c oxidases;electron carriers (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02238 COX7a Cytochrome c oxidase subunit VII
Representative CDS sequence
>Lus10020569 pacid=23172261 polypeptide=Lus10020569 locus=Lus10020569.g ID=Lus10020569.BGIv1.0 annot-version=v1.0
ATGGTTGAAGCAGAAACACCATTCAGACCAAGGGAGAAGCTCCTCGAGAAGCAGAGGTACTTCCAGAACACGCACAAGTACACCCACTTGAAAGGACCTA
TGGACAAGGTCACCTCCGTCGCTATCCCTTTAGCCTTGGCTGCAACCTCATTGTACCTCATTATTTTCAGAATGGTTGAAGCGGAAACACCTTTCAGACC
AAGGGAAAAGCTCATTGAGAAGCAGAGGTACTACCAGAACGTGCACAAGTACACCCACTTGAAAGGACCTATGGACAAGGTCACCTCTGTTGCTATCCCC
ATTGCTTTGGCCGCTACTTCGCTGTTTCTCATTGGCCGTGGCATCTACAACATGTCTCACGGGATCGGGAAGAAAGAATGA
AA sequence
>Lus10020569 pacid=23172261 polypeptide=Lus10020569 locus=Lus10020569.g ID=Lus10020569.BGIv1.0 annot-version=v1.0
MVEAETPFRPREKLLEKQRYFQNTHKYTHLKGPMDKVTSVAIPLALAATSLYLIIFRMVEAETPFRPREKLIEKQRYYQNVHKYTHLKGPMDKVTSVAIP
IALAATSLFLIGRGIYNMSHGIGKKE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G21105 cytochrome-c oxidases;electron... Lus10020569 0 1
AT3G03070 NADH-ubiquinone oxidoreductase... Lus10039147 9.1 0.7617
AT2G44360 unknown protein Lus10012711 11.5 0.7385
AT3G01390 AVMA10, VMA10 vacuolar membrane ATPase 10 (.... Lus10016977 18.6 0.6987
AT1G21900 emp24/gp25L/p24 family/GOLD fa... Lus10041939 21.6 0.7231
AT4G18372 Small nuclear ribonucleoprotei... Lus10042823 27.6 0.6927
AT5G61310 Cytochrome c oxidase subunit V... Lus10002429 30.3 0.7048
AT5G55630 ATTPK1, ATKCO1 TWO PORE K CHANNEL 1, TWO PORE... Lus10000044 33.5 0.6860
AT5G18800 Cox19-like CHCH family protein... Lus10012784 34.0 0.6703
AT5G61310 Cytochrome c oxidase subunit V... Lus10025028 34.9 0.6867
AT1G75270 DHAR2 dehydroascorbate reductase 2 (... Lus10023441 37.5 0.6711

Lus10020569 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.