Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27710 84 / 2e-22 60S acidic ribosomal protein family (.1.2.3.4) AT2G27720 84 / 4e-22 60S acidic ribosomal protein family (.1.2.3) AT3G44590 79 / 4e-20 60S acidic ribosomal protein family (.1.2) AT3G28500 74 / 3e-18 60S acidic ribosomal protein family (.1) AT5G40040 71 / 4e-17 60S acidic ribosomal protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006270 [exp] 119 / 1e-34 AT2G27710 100 / 9e-27 60S acidic ribosomal protein family (.1.2.3.4) Lus10043377 [exp] 108 / 3e-31 AT2G27710 102 / 8e-29 60S acidic ribosomal protein family (.1.2.3.4) Lus10019533 [exp] 109 / 8e-30 AT3G44620 262 / 6e-87 protein tyrosine phosphatases;protein tyrosine phosphatases (.1.2) Lus10026714 [exp] 96 / 1e-26 AT3G44590 96 / 6e-27 60S acidic ribosomal protein family (.1.2) Lus10019846 [exp] 94 / 3e-26 AT2G27710 92 / 2e-25 60S acidic ribosomal protein family (.1.2.3.4) Lus10014070 [exp] 94 / 5e-26 AT2G27710 92 / 1e-25 60S acidic ribosomal protein family (.1.2.3.4) Lus10026712 [exp] 97 / 1e-25 AT3G44590 97 / 2e-25 60S acidic ribosomal protein family (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G185800 [exp] 100 / 1e-28 AT2G27710 89 / 4e-24 60S acidic ribosomal protein family (.1.2.3.4) Potri.009G146200 [exp] 100 / 2e-28 AT2G27710 89 / 2e-24 60S acidic ribosomal protein family (.1.2.3.4) Potri.010G236400 [exp] 90 / 2e-24 AT2G27710 90 / 1e-24 60S acidic ribosomal protein family (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00428 [flax] [poplar] Ribosomal_60s 60s Acidic ribosomal protein
Representative CDS sequence Show only first row Show all	>Lus10020575 pacid=23172319 polypeptide=Lus10020575 locus=Lus10020575.g ID=Lus10020575.BGIv1.0 annot-version=v1.0 ATGAAGGTTGTCGCCGCTTACCTGCTCGCCGTCTTGGGTGGCAACAACACCCCCACCGCCGAGGATGTGAAGGGGATCCTTGGAACCGTTGGAGCCGATG CTGATGATGACAGGATTGAGCTGCTCTTGTGCCAAGTGAAAGGAAGGGACACCACTGAGCTGATTGCTGCTGGTATGGAGAAGTTAGCTTCAGTGCCATC AGGTGGTGGTGGTGTTGCAGTTGCTGCCTCTGCTGGCCCTGCTGCTGCCGGAGGTGGTGCTGCCCCAGCTGCCGAGGCCAAGAAGGAAGAGAAAGTTGAG GAGAAGGAAGAGTCTGATGACGATATGGGTTTCAGCTTGTTCGACTAA
AA sequence Show only first row Show all	>Lus10020575 pacid=23172319 polypeptide=Lus10020575 locus=Lus10020575.g ID=Lus10020575.BGIv1.0 annot-version=v1.0 MKVVAAYLLAVLGGNNTPTAEDVKGILGTVGADADDDRIELLLCQVKGRDTTELIAAGMEKLASVPSGGGGVAVAASAGPAAAGGGAAPAAEAKKEEKVE EKEESDDDMGFSLFD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G44590			60S acidic ribosomal protein f...		Lus10020575 [exp]	0	1
AT5G57290			60S acidic ribosomal protein f...		Lus10010890 [exp]	2.0	0.9477
AT1G23290		RPL27A, RPL27AB	RIBOSOMAL PROTEIN L27A, Riboso...		Lus10004617 [exp]	5.5	0.9458
AT4G16720			Ribosomal protein L23/L15e fam...		Lus10004743 [exp]	6.6	0.9508
AT4G23620			Ribosomal protein L25/Gln-tRNA...		Lus10000590 [exp]	6.7	0.9223
AT2G04390			Ribosomal S17 family protein (...		Lus10004208 [exp]	16.4	0.9324
AT3G57490			Ribosomal protein S5 family pr...		Lus10027358 [exp]	16.6	0.9357
AT5G61030		GR-RBP3	glycine-rich RNA-binding prote...		Lus10034685 [exp]	18.2	0.9280
AT1G23100			GroES-like family protein (.1)		Lus10036055 [exp]	19.7	0.8925
AT3G05590		RPL18	ribosomal protein L18 (.1)		Lus10015198 [exp]	20.0	0.9327
AT2G04390			Ribosomal S17 family protein (...		Lus10029412 [exp]	21.0	0.9190

Compare expression of checked genes

Lus10020575 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.