Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27680 108 / 3e-29 NAD(P)-linked oxidoreductase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006267 [exp] 181 / 8e-57 AT2G27680 494 / 6e-175 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10020578 [exp] 81 / 4e-19 AT2G27680 595 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G146000 [exp] 109 / 1e-29 AT2G27680 632 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020579 pacid=23172332 polypeptide=Lus10020579 locus=Lus10020579.g ID=Lus10020579.BGIv1.0 annot-version=v1.0 ATGTCGGCATCGGTACATCAAATTCAGCCTAAACTCGCCGCGTTGAAGCTCTCCTCCAGCCGGAATCCGCCGCCATCCCGACTTGGATTGGTAAGATGCT GTTCCTACGGGCCAGCGCCGGCTGAGGTGAAGGAGTCCCGACGAGTGGAGTTGAAGAACGGAAACGATTCGCTGGAGATAAGCCGAATTCTCAACGGGAT GTGGCAGACTAGCGGAGGATGGGGAAGTATCGACCGGCACGACGCCGTTGATGCCATGCTCCGTTACTCCGACGCCGGCCTTTCCACCTTCGACATGGCC GACCACTGTAAGTTGAAGAAACCAAAATTTGAAAAAGACTTCGTCTTTGTGTAG
AA sequence Show only first row Show all	>Lus10020579 pacid=23172332 polypeptide=Lus10020579 locus=Lus10020579.g ID=Lus10020579.BGIv1.0 annot-version=v1.0 MSASVHQIQPKLAALKLSSSRNPPPSRLGLVRCCSYGPAPAEVKESRRVELKNGNDSLEISRILNGMWQTSGGWGSIDRHDAVDAMLRYSDAGLSTFDMA DHCKLKKPKFEKDFVFV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G27680			NAD(P)-linked oxidoreductase s...		Lus10020579 [exp]	0	1
AT5G03940		SRP54CP, CPSRP5...	SIGNAL RECOGNITION PARTICLE 54...		Lus10017023 [exp]	4.4	0.9108
AT1G09900			Pentatricopeptide repeat (PPR-...		Lus10031565 [exp]	8.3	0.8961
AT1G80030			Molecular chaperone Hsp40/DnaJ...		Lus10011484 [exp]	8.5	0.8811
AT5G03940		SRP54CP, CPSRP5...	SIGNAL RECOGNITION PARTICLE 54...		Lus10021346 [exp]	11.7	0.8981
AT3G23760			unknown protein		Lus10043212 [exp]	13.5	0.8823
AT5G08280		HEMC	hydroxymethylbilane synthase (...		Lus10013439 [exp]	14.4	0.8629
AT1G48520		GATB	GLU-ADT subunit B (.1.2.3)		Lus10012905 [exp]	15.5	0.8755
AT3G53460		CP29	chloroplast RNA-binding protei...		Lus10023191 [exp]	15.9	0.8892
AT5G42310			Pentatricopeptide repeat (PPR-...		Lus10012268 [exp]	16.1	0.8884
AT3G02450			cell division protein ftsH, pu...		Lus10034097 [exp]	16.9	0.8784

Compare expression of checked genes

Lus10020579 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.