Lus10020586 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G27610 73 / 2e-15 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G41080 59 / 2e-10 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G13600 57 / 8e-10 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G02330 57 / 8e-10 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G30700 56 / 2e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G20230 55 / 3e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G06150 54 / 6e-09 bHLH bHLH089, EMB1444 EMBRYO DEFECTIVE 1444, basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2)
AT3G09040 54 / 8e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G71460 53 / 1e-08 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT5G15340 53 / 1e-08 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004892 310 / 2e-101 AT2G27610 998 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10016509 60 / 5e-11 AT1G11290 361 / 1e-114 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10031994 56 / 2e-09 AT3G02010 957 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10035164 55 / 3e-09 AT3G02010 962 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10029884 55 / 4e-09 AT1G77170 543 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10040776 54 / 5e-09 AT1G11290 272 / 7e-82 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10014594 54 / 7e-09 AT3G02330 901 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10011900 54 / 9e-09 AT5G66520 281 / 4e-88 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10032091 54 / 1e-08 AT3G02330 925 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G184800 121 / 2e-32 AT2G27610 1061 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.002G075300 61 / 2e-11 AT3G26540 815 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G211400 61 / 3e-11 AT3G11460 772 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.007G021700 57 / 5e-10 AT3G47840 796 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G060600 56 / 2e-09 AT3G24000 331 / 3e-106 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.015G018700 54 / 7e-09 AT3G49170 1040 / 0.0 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.015G047600 54 / 1e-08 AT1G18485 1077 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G059400 53 / 1e-08 AT4G18750 1110 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.013G044700 53 / 2e-08 AT3G22690 582 / 0.0 unknown protein
Potri.009G035100 52 / 4e-08 AT4G13650 397 / 8e-126 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10020586 pacid=23172276 polypeptide=Lus10020586 locus=Lus10020586.g ID=Lus10020586.BGIv1.0 annot-version=v1.0
ATGAGAACTCAGACCCTTTCGAGAACAGTGAAAACCAACTTCATTGCTCGACGACATCAGGCCGGATTCGGATTCAGTGAATCGCATTTCCACTCAGTGG
CTTTAGAGAAGGATGAACCTGACAATGCACACCACCTGTTCGAGAAAAGTCCTGACCAGGCAGGAAACTCGAATGATGCACACCAACTATTCTACGAAAG
TCCTGACCGGGCAGGAAATTCGAACCGCTTGCTTTTCAAGCGGTCACGAAACAACAGACACTCTGACGTGGTGAATCTCTTTGTGGGCATTCATCGCCCC
GGATTTCCTGTTGATGGATGCACAATTTCCTGTGTGTTCAAAGCCTGTGCATACTCGCTTGATCAAACACTTGGAGTCCAAATCCATGGCTACTCCACAA
ACCATGGACTTTTGCAAGATGTCAGCGTTGGAACTTCAATGGGTGACATGTACTTCAAGAACGGCAGAGTCGTTGAAGGAAGGAGATTCTTAGATTAA
AA sequence
>Lus10020586 pacid=23172276 polypeptide=Lus10020586 locus=Lus10020586.g ID=Lus10020586.BGIv1.0 annot-version=v1.0
MRTQTLSRTVKTNFIARRHQAGFGFSESHFHSVALEKDEPDNAHHLFEKSPDQAGNSNDAHQLFYESPDRAGNSNRLLFKRSRNNRHSDVVNLFVGIHRP
GFPVDGCTISCVFKACAYSLDQTLGVQIHGYSTNHGLLQDVSVGTSMGDMYFKNGRVVEGRRFLD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G27610 Tetratricopeptide repeat (TPR)... Lus10020586 0 1
AT5G46090 Protein of unknown function (D... Lus10033645 6.2 0.6516
Lus10037868 14.6 0.6307
AT5G59190 subtilase family protein (.1) Lus10040747 21.5 0.6293
Lus10038051 24.3 0.6228
AT5G01660 unknown protein Lus10040599 26.6 0.6228
AT3G12750 ZIP1 zinc transporter 1 precursor (... Lus10014062 28.7 0.6228
Lus10029261 30.7 0.6228
AT5G56990 unknown protein Lus10029528 32.6 0.6228
AT4G27420 ABCG9 ATP-binding cassette G9, ABC-2... Lus10029635 34.4 0.6228
Lus10003825 36.0 0.6228

Lus10020586 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.