Lus10020596 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06620 199 / 6e-63 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G06650 187 / 2e-58 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT5G59530 185 / 1e-57 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G59540 184 / 2e-57 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT1G06640 182 / 3e-56 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
AT1G04380 181 / 4e-56 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G04350 180 / 1e-55 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT2G30840 178 / 6e-55 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G43440 178 / 9e-55 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT2G30830 176 / 3e-54 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004888 326 / 1e-112 AT1G06620 392 / 1e-135 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022195 218 / 6e-70 AT1G06620 432 / 1e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10027585 215 / 5e-69 AT1G06620 429 / 3e-150 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10021203 210 / 4e-67 AT1G06620 416 / 2e-145 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022196 209 / 5e-67 AT5G59530 420 / 5e-147 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022415 205 / 4e-65 AT1G06620 432 / 6e-152 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022197 203 / 1e-64 AT1G06620 434 / 6e-153 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10041230 197 / 3e-64 AT5G59530 270 / 1e-90 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10021943 200 / 3e-63 AT1G06620 443 / 5e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G073166 215 / 3e-69 AT1G06620 470 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073300 208 / 1e-66 AT1G06620 455 / 7e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073100 199 / 5e-63 AT1G06650 414 / 2e-144 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.010G073232 197 / 3e-62 AT1G06620 402 / 7e-140 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.011G156200 181 / 7e-56 AT1G06650 430 / 7e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.008G165400 179 / 4e-55 AT1G06620 444 / 1e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.013G045000 159 / 3e-47 AT1G06620 369 / 6e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.017G135800 145 / 9e-42 AT1G06620 323 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.002G040700 142 / 9e-41 AT1G06620 330 / 2e-111 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.005G222300 139 / 1e-39 AT1G06620 340 / 3e-115 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10020596 pacid=23172291 polypeptide=Lus10020596 locus=Lus10020596.g ID=Lus10020596.BGIv1.0 annot-version=v1.0
ATGGCCCCGGTTCCGCTAGAACCGGTCGAGTTTCCGGGTTGCTGCAGGGAAATCGTGATGGAGTACGCGAACGAAATAAAGAAACTCAGGGACCTACTTC
TGACTCTGTTGTCCGAGGCTCTAGGTCTTGACTCGAATCACCGGACCGAGTTAGAATGTGTAAAAGGGTTAAACTTGATGGGTCATTACTACCCACCTTG
CCCTGAACCAGAGCTAACTATGGGGACAAGGATGCATCAAGATGATAGTTTCTTCACTGTGATTCAACAAGATTATATTGGTGGACTTCAAGTTCTTCAT
AATGACAAGCTGGTTGATTTAACTCCTACACCAAGTGCTCTTGTGGTAAATATTGGGAGTTTACTCGAATTCATAAGTTCGGAGCACATGGTGGTAGCGA
ACCGGGTGGGACCAAGAGTATCGATAGGTTCGTTTTTCAGCACGGATAACGTACTATCGAACCCGAGGATGTACGGACCGATCAAGAAGCTGTTATCGGA
GAACAATCGGCCGAAGTACAAGAATGTATCGGTTAAAGATTATCAAGCAAAGTTCCACAGTGAGGGTCTCAATGGGACTTCTGCTTTGGTTCACTTTCAC
CTATGA
AA sequence
>Lus10020596 pacid=23172291 polypeptide=Lus10020596 locus=Lus10020596.g ID=Lus10020596.BGIv1.0 annot-version=v1.0
MAPVPLEPVEFPGCCREIVMEYANEIKKLRDLLLTLLSEALGLDSNHRTELECVKGLNLMGHYYPPCPEPELTMGTRMHQDDSFFTVIQQDYIGGLQVLH
NDKLVDLTPTPSALVVNIGSLLEFISSEHMVVANRVGPRVSIGSFFSTDNVLSNPRMYGPIKKLLSENNRPKYKNVSVKDYQAKFHSEGLNGTSALVHFH
L

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Lus10020596 0 1

Lus10020596 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.