Lus10020599 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G21720 355 / 5e-127 PBC1 proteasome beta subunit C1 (.1)
AT1G77440 351 / 4e-125 PBC2 20S proteasome beta subunit C2 (.1.2)
AT3G60820 74 / 3e-16 PBF1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
AT4G31300 42 / 0.0001 PBA1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004885 396 / 5e-143 AT1G21720 356 / 2e-127 proteasome beta subunit C1 (.1)
Lus10015867 79 / 6e-18 AT3G60820 379 / 2e-135 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Lus10009294 76 / 6e-16 AT1G48050 835 / 0.0 ARABIDOPSIS THALIANA KU80 HOMOLOG, Ku80 family protein (.1)
Lus10006426 62 / 2e-11 AT3G26340 462 / 7e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Lus10011369 62 / 2e-11 AT3G26340 465 / 1e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G180500 356 / 4e-127 AT1G21720 391 / 9e-141 proteasome beta subunit C1 (.1)
Potri.002G080800 352 / 8e-126 AT1G21720 383 / 1e-137 proteasome beta subunit C1 (.1)
Potri.002G148300 73 / 5e-16 AT3G60820 387 / 2e-138 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Potri.014G069800 70 / 8e-15 AT3G60820 362 / 6e-129 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Potri.008G177000 64 / 2e-12 AT3G26340 473 / 7e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Potri.018G145900 42 / 6e-05 AT4G31300 405 / 3e-145 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Potri.006G077900 39 / 0.0007 AT4G31300 416 / 2e-149 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0052 NTN PF00227 Proteasome Proteasome subunit
Representative CDS sequence
>Lus10020599 pacid=23172316 polypeptide=Lus10020599 locus=Lus10020599.g ID=Lus10020599.BGIv1.0 annot-version=v1.0
ATGGTGGGGAAGAACTGCTTTGCTATAGCTAGCGATCGCCGATTGGGAGTCCAGCTCCAGACTGTCGCCACGGATTTCCAGCGCATCTACAAAATTCACG
ACAAGCTCTTCTTCGGGCTTTCTGGCTTGGCCTCCGACGCTCAGACTTTGCATCAGAGGCTGATGTTCCGCCATAAGCTGTATCAGCTGAGGGAAGAGAG
GGATATGAAGCCTGAGACTTTCTCCAGCCTTGTCTCCGCTATTCTTTATGAGAAAAGGTTTGGTCCATATTTCGTCCAACCTGTAATTGCTGGACTAAGC
GATGATGATCAGCCATTCATTTGTACGATGGATGCTATTGGTGCTAAGGAATTGGCAAAAGATTTTGTCGTTGGAGGCACAGCTGGAGAGTCTCTTTATG
GTGCTTGTGAGGCAATGTTCAAGCCTGACATGGAACCCGAGGAGTTATTCGAAACTCTGTCACAAGCGCTTTTGGCTTCAGTGGATCGAGATTGTCTAAG
TGGATGGGGAGGACACATCTATCTTGTTACCCCAACTGAGATCAAAGAATGCACCTTGAAGGGAAGGATGGACTGA
AA sequence
>Lus10020599 pacid=23172316 polypeptide=Lus10020599 locus=Lus10020599.g ID=Lus10020599.BGIv1.0 annot-version=v1.0
MVGKNCFAIASDRRLGVQLQTVATDFQRIYKIHDKLFFGLSGLASDAQTLHQRLMFRHKLYQLREERDMKPETFSSLVSAILYEKRFGPYFVQPVIAGLS
DDDQPFICTMDAIGAKELAKDFVVGGTAGESLYGACEAMFKPDMEPEELFETLSQALLASVDRDCLSGWGGHIYLVTPTEIKECTLKGRMD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G21720 PBC1 proteasome beta subunit C1 (.1... Lus10020599 0 1
AT3G19760 EIF4A-III eukaryotic initiation factor 4... Lus10010206 5.1 0.7927
AT1G56450 PBG1 20S proteasome beta subunit G1... Lus10011640 6.2 0.7832
AT5G23535 KOW domain-containing protein ... Lus10006905 10.5 0.7937
AT1G56450 PBG1 20S proteasome beta subunit G1... Lus10036124 12.7 0.8254
AT3G25230 ROF1, ATFKBP62 FK506 BINDING PROTEIN 62, rota... Lus10038216 27.9 0.8017
AT5G23540 Mov34/MPN/PAD-1 family protein... Lus10031085 30.3 0.8120
AT1G23100 GroES-like family protein (.1) Lus10036055 37.5 0.8013
AT5G59440 ATTMPK.2, ATTMP... ZEUS1, ARABIDOPSIS THALIANA TH... Lus10035500 41.0 0.7560
AT5G20720 CHCPN10, ATCPN2... CHLOROPLAST CHAPERONIN 10, cha... Lus10021244 43.0 0.7135
AT1G60770 Tetratricopeptide repeat (TPR)... Lus10029115 49.0 0.8013

Lus10020599 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.