Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G22460 103 / 6e-28 alpha/beta-Hydrolases superfamily protein (.1.2) AT3G48410 91 / 6e-23 alpha/beta-Hydrolases superfamily protein (.1) AT1G74280 84 / 2e-20 alpha/beta-Hydrolases superfamily protein (.1) AT1G74290 83 / 7e-20 alpha/beta-Hydrolases superfamily protein (.1) AT1G74300 80 / 8e-19 alpha/beta-Hydrolases superfamily protein (.1) AT3G03240 76 / 1e-17 alpha/beta-Hydrolases superfamily protein (.1) AT3G44510 76 / 2e-17 alpha/beta-Hydrolases superfamily protein (.1.2) AT3G03230 75 / 4e-17 alpha/beta-Hydrolases superfamily protein (.1) AT2G36290 74 / 1e-16 alpha/beta-Hydrolases superfamily protein (.1) AT1G08310 71 / 1e-15 alpha/beta-Hydrolases superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004880 [exp] 146 / 7e-44 AT5G22460 439 / 7e-155 alpha/beta-Hydrolases superfamily protein (.1.2) Lus10004882 [exp] 131 / 2e-38 AT5G22460 345 / 1e-118 alpha/beta-Hydrolases superfamily protein (.1.2) Lus10028853 [exp] 93 / 2e-25 AT1G74300 140 / 2e-41 alpha/beta-Hydrolases superfamily protein (.1) Lus10034148 [exp] 91 / 1e-22 AT2G36290 436 / 1e-153 alpha/beta-Hydrolases superfamily protein (.1) Lus10008968 [exp] 91 / 1e-22 AT2G36290 442 / 5e-156 alpha/beta-Hydrolases superfamily protein (.1) Lus10043437 [exp] 90 / 1e-22 AT2G36290 429 / 5e-151 alpha/beta-Hydrolases superfamily protein (.1) Lus10020603 [exp] 86 / 8e-22 AT5G22460 230 / 6e-75 alpha/beta-Hydrolases superfamily protein (.1.2) Lus10028860 [exp] 87 / 1e-21 AT2G36290 433 / 1e-152 alpha/beta-Hydrolases superfamily protein (.1) Lus10017051 [exp] 87 / 2e-21 AT3G48410 489 / 1e-173 alpha/beta-Hydrolases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G203700 [exp] 116 / 1e-32 AT5G22460 434 / 2e-153 alpha/beta-Hydrolases superfamily protein (.1.2) Potri.009G164900 [exp] 98 / 2e-25 AT5G22460 374 / 1e-129 alpha/beta-Hydrolases superfamily protein (.1.2) Potri.008G021400 [exp] 83 / 4e-20 AT2G36290 446 / 2e-157 alpha/beta-Hydrolases superfamily protein (.1) Potri.010G237800 [exp] 83 / 6e-20 AT2G36290 436 / 1e-153 alpha/beta-Hydrolases superfamily protein (.1) Potri.010G237700 [exp] 82 / 9e-20 AT2G36290 452 / 6e-160 alpha/beta-Hydrolases superfamily protein (.1) Potri.009G164600 [exp] 81 / 2e-19 AT3G44510 440 / 5e-156 alpha/beta-Hydrolases superfamily protein (.1.2) Potri.008G021200 [exp] 77 / 5e-18 AT2G36290 433 / 1e-152 alpha/beta-Hydrolases superfamily protein (.1) Potri.008G021000 [exp] 74 / 1e-16 AT2G36290 441 / 5e-155 alpha/beta-Hydrolases superfamily protein (.1) Potri.008G021301 [exp] 51 / 3e-09 AT1G74300 65 / 2e-13 alpha/beta-Hydrolases superfamily protein (.1) Potri.016G086200 [exp] 44 / 4e-06 AT5G02970 653 / 0.0 alpha/beta-Hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020604 pacid=23172265 polypeptide=Lus10020604 locus=Lus10020604.g ID=Lus10020604.BGIv1.0 annot-version=v1.0 ATGTTGTTTCTGGCGGTAACTGTGGCGTTAATAGTGGCAGTTTTGGGATGGATTTACCAGTACTCGTTGAAGCCTCCACCTTCGAGAATCGACGATTCTT CCAGTGGCCCGACAATCACTTCTCCAAGGGTAAAGCTTCATGATGGGAGGCATTTGGCTTACAAGGAAATGAGAATTTCCAAGGAAGAAGCTAAGCATAA GATCATCATCATTCATGGGTTCAATGCTTCTAAAGATTTGTGGTATCCTTTCCCACAGGAACTTATGGAGGAACTGAGCATATACATATTAACCTTTGAT AAATCGGGATATGGCGAGAGTGATCCATATCCGTCGTGA
AA sequence Show only first row Show all	>Lus10020604 pacid=23172265 polypeptide=Lus10020604 locus=Lus10020604.g ID=Lus10020604.BGIv1.0 annot-version=v1.0 MLFLAVTVALIVAVLGWIYQYSLKPPPSRIDDSSSGPTITSPRVKLHDGRHLAYKEMRISKEEAKHKIIIIHGFNASKDLWYPFPQELMEELSIYILTFD KSGYGESDPYPS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G22460			alpha/beta-Hydrolases superfam...		Lus10020604 [exp]	0	1
AT1G24764		ATMAP70-2	microtubule-associated protein...		Lus10039069 [exp]	3.7	0.9364
AT1G54520			unknown protein		Lus10006109 [exp]	4.9	0.9137
					Lus10028069 [exp]	6.3	0.9327
AT5G42930			alpha/beta-Hydrolases superfam...		Lus10042648 [exp]	8.7	0.9313
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Lus10036314 [exp]	9.2	0.8325
AT3G22640		PAP85	cupin family protein (.1)		Lus10022072 [exp]	9.6	0.9175
AT4G23310		CRK23	cysteine-rich RLK (RECEPTOR-li...		Lus10023335 [exp]	10.2	0.9118
AT2G04160		AIR3	AUXIN-INDUCED IN ROOT CULTURES...		Lus10032424 [exp]	11.2	0.9141
AT2G31390		STH	pfkB-like carbohydrate kinase ...		Lus10039195 [exp]	11.5	0.8665
AT2G38080		ATLMCO4, IRX12,...	LACCASE 4, IRREGULAR XYLEM 12,...		Lus10040226 [exp]	12.5	0.9025

Compare expression of checked genes

Lus10020604 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.