Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G48410 76 / 7e-18 alpha/beta-Hydrolases superfamily protein (.1) AT3G54240 72 / 1e-16 alpha/beta-Hydrolases superfamily protein (.1) AT5G22460 69 / 8e-16 alpha/beta-Hydrolases superfamily protein (.1.2) AT2G36290 66 / 1e-14 alpha/beta-Hydrolases superfamily protein (.1) AT1G74280 62 / 6e-13 alpha/beta-Hydrolases superfamily protein (.1) AT1G74300 61 / 7e-13 alpha/beta-Hydrolases superfamily protein (.1) AT1G74290 60 / 2e-12 alpha/beta-Hydrolases superfamily protein (.1) AT3G44510 55 / 1e-10 alpha/beta-Hydrolases superfamily protein (.1.2) AT3G03230 49 / 1e-08 alpha/beta-Hydrolases superfamily protein (.1) AT3G03240 45 / 3e-07 alpha/beta-Hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004882 [exp] 141 / 5e-43 AT5G22460 345 / 1e-118 alpha/beta-Hydrolases superfamily protein (.1.2) Lus10004880 [exp] 95 / 6e-25 AT5G22460 439 / 7e-155 alpha/beta-Hydrolases superfamily protein (.1.2) Lus10004881 [exp] 85 / 7e-22 AT3G48410 173 / 2e-52 alpha/beta-Hydrolases superfamily protein (.1) Lus10028860 [exp] 71 / 2e-16 AT2G36290 433 / 1e-152 alpha/beta-Hydrolases superfamily protein (.1) Lus10008960 [exp] 69 / 1e-15 AT2G36290 353 / 8e-122 alpha/beta-Hydrolases superfamily protein (.1) Lus10021371 [exp] 69 / 2e-15 AT3G48410 473 / 2e-167 alpha/beta-Hydrolases superfamily protein (.1) Lus10017051 [exp] 68 / 4e-15 AT3G48410 489 / 1e-173 alpha/beta-Hydrolases superfamily protein (.1) Lus10034135 [exp] 66 / 3e-14 AT3G48410 396 / 9e-138 alpha/beta-Hydrolases superfamily protein (.1) Lus10043449 [exp] 64 / 7e-14 AT3G48410 395 / 2e-137 alpha/beta-Hydrolases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G203700 [exp] 86 / 6e-22 AT5G22460 434 / 2e-153 alpha/beta-Hydrolases superfamily protein (.1.2) Potri.008G021400 [exp] 72 / 7e-17 AT2G36290 446 / 2e-157 alpha/beta-Hydrolases superfamily protein (.1) Potri.010G237700 [exp] 71 / 2e-16 AT2G36290 452 / 6e-160 alpha/beta-Hydrolases superfamily protein (.1) Potri.010G237800 [exp] 67 / 9e-15 AT2G36290 436 / 1e-153 alpha/beta-Hydrolases superfamily protein (.1) Potri.009G164900 [exp] 64 / 7e-14 AT5G22460 374 / 1e-129 alpha/beta-Hydrolases superfamily protein (.1.2) Potri.008G021000 [exp] 64 / 1e-13 AT2G36290 441 / 5e-155 alpha/beta-Hydrolases superfamily protein (.1) Potri.009G164600 [exp] 62 / 3e-13 AT3G44510 440 / 5e-156 alpha/beta-Hydrolases superfamily protein (.1.2) Potri.008G021200 [exp] 62 / 4e-13 AT2G36290 433 / 1e-152 alpha/beta-Hydrolases superfamily protein (.1) Potri.006G131300 [exp] 40 / 2e-05 AT5G02970 658 / 0.0 alpha/beta-Hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020605 pacid=23172374 polypeptide=Lus10020605 locus=Lus10020605.g ID=Lus10020605.BGIv1.0 annot-version=v1.0 ATGGACTTGACCGATCCATTTCCGAATGGTGGAGGTGCGGTACACATGTGGCAGGGTTCCGATGACCGGATTACTCGACCGCAGATAAACCGGTTTGTGG CGGAAAAGCTTCCATGGATTCGGTACCATGAGGTTGAAGACACTGGTCATCCTTTCAGGGAGGAACAATATGAGGCATTTCTAAGAACACTAATTGGTCA TACTTGA
AA sequence Show only first row Show all	>Lus10020605 pacid=23172374 polypeptide=Lus10020605 locus=Lus10020605.g ID=Lus10020605.BGIv1.0 annot-version=v1.0 MDLTDPFPNGGGAVHMWQGSDDRITRPQINRFVAEKLPWIRYHEVEDTGHPFREEQYEAFLRTLIGHT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G48410			alpha/beta-Hydrolases superfam...		Lus10020605 [exp]	0	1

Compare expression of checked genes

Lus10020605 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.